Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 572761..572986 | Replicon | chromosome |
| Accession | NZ_CP015853 | ||
| Organism | Escherichia coli strain ATCC 43889 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | A8714_RS03310 | Protein ID | WP_000813258.1 |
| Coordinates | 572831..572986 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 572761..572819 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A8714_RS03260 | 567814..568056 | + | 243 | WP_000747948.1 | hypothetical protein | - |
| A8714_RS03265 | 568040..568465 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
| A8714_RS03270 | 568534..569589 | + | 1056 | WP_001356791.1 | hypothetical protein | - |
| A8714_RS03275 | 569582..570043 | + | 462 | WP_000139447.1 | replication protein | - |
| A8714_RS03280 | 570077..570793 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| A8714_RS03285 | 570826..571107 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
| A8714_RS03290 | 571104..571331 | + | 228 | WP_000699809.1 | hypothetical protein | - |
| A8714_RS03295 | 571324..571635 | + | 312 | WP_001289673.1 | hypothetical protein | - |
| A8714_RS03300 | 571763..571981 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
| A8714_RS03305 | 571983..572540 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| - | 572761..572819 | - | 59 | - | - | Antitoxin |
| A8714_RS03310 | 572831..572986 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| A8714_RS03315 | 573106..573450 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| A8714_RS03320 | 573572..573844 | + | 273 | WP_000191871.1 | hypothetical protein | - |
| A8714_RS03325 | 573846..574895 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| A8714_RS03330 | 574908..575213 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| A8714_RS03335 | 575276..575830 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
| A8714_RS03340 | 576055..576252 | + | 198 | WP_000917763.1 | hypothetical protein | - |
| A8714_RS03345 | 576387..577100 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| A8714_RS03360 | 577551..577982 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 512103..610432 | 98329 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T63792 WP_000813258.1 NZ_CP015853:572831-572986 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T63792 NZ_CP015853:572831-572986 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT63792 NZ_CP015853:c572819-572761 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|