Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2209523..2209748 | Replicon | chromosome |
Accession | NZ_CP015846 | ||
Organism | Escherichia coli O157:H7 strain FRIK2069 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | A8V30_RS11935 | Protein ID | WP_000813258.1 |
Coordinates | 2209523..2209678 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2209690..2209748 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A8V30_RS11885 | 2204526..2204957 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
A8V30_RS11900 | 2205408..2206121 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
A8V30_RS11905 | 2206257..2206454 | - | 198 | WP_000917763.1 | hypothetical protein | - |
A8V30_RS11910 | 2206679..2207233 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
A8V30_RS11915 | 2207296..2207601 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
A8V30_RS11920 | 2207614..2208663 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
A8V30_RS11925 | 2208665..2208937 | - | 273 | WP_000191872.1 | hypothetical protein | - |
A8V30_RS11930 | 2209059..2209403 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
A8V30_RS11935 | 2209523..2209678 | - | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 2209690..2209748 | + | 59 | - | - | Antitoxin |
A8V30_RS11940 | 2209969..2210526 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
A8V30_RS11945 | 2210528..2210746 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
A8V30_RS11950 | 2210874..2211185 | - | 312 | WP_001289673.1 | hypothetical protein | - |
A8V30_RS11955 | 2211178..2211405 | - | 228 | WP_000699809.1 | hypothetical protein | - |
A8V30_RS11960 | 2211402..2211683 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
A8V30_RS11965 | 2211716..2212432 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
A8V30_RS31275 | 2212466..2212927 | - | 462 | WP_000139447.1 | replication protein | - |
A8V30_RS31280 | 2212920..2213963 | - | 1044 | WP_001262402.1 | hypothetical protein | - |
A8V30_RS11980 | 2214032..2214457 | - | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
A8V30_RS11985 | 2214441..2214683 | - | 243 | WP_000747948.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2172411..2261669 | 89258 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T63744 WP_000813258.1 NZ_CP015846:c2209678-2209523 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T63744 NZ_CP015846:c2209678-2209523 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT63744 NZ_CP015846:2209690-2209748 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|