Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1846613..1846838 | Replicon | chromosome |
Accession | NZ_CP015846 | ||
Organism | Escherichia coli O157:H7 strain FRIK2069 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | A8V30_RS10090 | Protein ID | WP_000813254.1 |
Coordinates | 1846683..1846838 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1846613..1846671 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A8V30_RS10040 | 1841866..1842819 | + | 954 | WP_000095667.1 | helix-turn-helix domain-containing protein | - |
A8V30_RS10045 | 1842826..1843566 | + | 741 | WP_000790456.1 | ATP-binding protein | - |
A8V30_RS10050 | 1843596..1844366 | + | 771 | WP_000450888.1 | DUF1627 domain-containing protein | - |
A8V30_RS10055 | 1844382..1844777 | + | 396 | WP_001118161.1 | DUF977 family protein | - |
A8V30_RS10060 | 1844834..1845190 | + | 357 | WP_001302146.1 | hypothetical protein | - |
A8V30_RS10065 | 1845239..1845451 | + | 213 | WP_000063625.1 | hypothetical protein | - |
A8V30_RS10070 | 1845487..1845858 | + | 372 | WP_000137941.1 | hypothetical protein | - |
A8V30_RS10075 | 1845855..1846217 | + | 363 | WP_000610379.1 | DUF551 domain-containing protein | - |
A8V30_RS10080 | 1846333..1846437 | + | 105 | WP_001278450.1 | hypothetical protein | - |
- | 1846613..1846671 | - | 59 | - | - | Antitoxin |
A8V30_RS10090 | 1846683..1846838 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
A8V30_RS31720 | 1847135..1847302 | + | 168 | WP_000998188.1 | hypothetical protein | - |
A8V30_RS10095 | 1847368..1847646 | + | 279 | WP_001304183.1 | hypothetical protein | - |
A8V30_RS10100 | 1847648..1848697 | + | 1050 | Protein_1821 | DUF968 domain-containing protein | - |
A8V30_RS10105 | 1848710..1849084 | + | 375 | WP_000904137.1 | RusA family crossover junction endodeoxyribonuclease | - |
A8V30_RS10110 | 1849081..1849902 | + | 822 | WP_000762904.1 | antitermination protein | - |
A8V30_RS10115 | 1850129..1850326 | + | 198 | WP_000917735.1 | hypothetical protein | - |
A8V30_RS10120 | 1850477..1851535 | + | 1059 | WP_000483497.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | paa / nleA/espI / espM1 | 1772901..1878915 | 106014 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T63741 WP_000813254.1 NZ_CP015846:1846683-1846838 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T63741 NZ_CP015846:1846683-1846838 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT63741 NZ_CP015846:c1846671-1846613 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|