Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1846616..1846841 | Replicon | chromosome |
Accession | NZ_CP015843 | ||
Organism | Escherichia coli O157:H7 strain FRIK2455 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | A8V32_RS10090 | Protein ID | WP_000813254.1 |
Coordinates | 1846686..1846841 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1846616..1846674 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A8V32_RS10040 | 1841869..1842822 | + | 954 | WP_000095667.1 | helix-turn-helix domain-containing protein | - |
A8V32_RS10045 | 1842829..1843569 | + | 741 | WP_000790456.1 | ATP-binding protein | - |
A8V32_RS10050 | 1843599..1844369 | + | 771 | WP_000450888.1 | DUF1627 domain-containing protein | - |
A8V32_RS10055 | 1844385..1844780 | + | 396 | WP_001118161.1 | DUF977 family protein | - |
A8V32_RS10060 | 1844837..1845193 | + | 357 | WP_001302146.1 | hypothetical protein | - |
A8V32_RS10065 | 1845242..1845454 | + | 213 | WP_000063625.1 | hypothetical protein | - |
A8V32_RS10070 | 1845490..1845861 | + | 372 | WP_000137941.1 | hypothetical protein | - |
A8V32_RS10075 | 1845858..1846220 | + | 363 | WP_000610379.1 | DUF551 domain-containing protein | - |
A8V32_RS10080 | 1846336..1846440 | + | 105 | WP_001278450.1 | hypothetical protein | - |
- | 1846616..1846674 | - | 59 | - | - | Antitoxin |
A8V32_RS10090 | 1846686..1846841 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
A8V32_RS31965 | 1847138..1847305 | + | 168 | WP_000998188.1 | hypothetical protein | - |
A8V32_RS10095 | 1847371..1847649 | + | 279 | WP_001304183.1 | hypothetical protein | - |
A8V32_RS10100 | 1847651..1848700 | + | 1050 | Protein_1824 | DUF968 domain-containing protein | - |
A8V32_RS10105 | 1848713..1849087 | + | 375 | WP_000904137.1 | RusA family crossover junction endodeoxyribonuclease | - |
A8V32_RS10110 | 1849084..1849905 | + | 822 | WP_000762904.1 | antitermination protein | - |
A8V32_RS10115 | 1850132..1850329 | + | 198 | WP_000917735.1 | hypothetical protein | - |
A8V32_RS10120 | 1850480..1851538 | + | 1059 | WP_000483497.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | paa / nleA/espI / espM1 | 1772908..1889750 | 116842 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T63697 WP_000813254.1 NZ_CP015843:1846686-1846841 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T63697 NZ_CP015843:1846686-1846841 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT63697 NZ_CP015843:c1846674-1846616 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|