Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1846603..1846828 | Replicon | chromosome |
Accession | NZ_CP015842 | ||
Organism | Escherichia coli O157:H7 strain FRIK2533 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | A8V31_RS10085 | Protein ID | WP_000813254.1 |
Coordinates | 1846673..1846828 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1846603..1846661 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A8V31_RS10035 | 1841856..1842809 | + | 954 | WP_000095667.1 | helix-turn-helix domain-containing protein | - |
A8V31_RS10040 | 1842816..1843556 | + | 741 | WP_000790456.1 | ATP-binding protein | - |
A8V31_RS10045 | 1843586..1844356 | + | 771 | WP_000450888.1 | DUF1627 domain-containing protein | - |
A8V31_RS10050 | 1844372..1844767 | + | 396 | WP_001118161.1 | DUF977 family protein | - |
A8V31_RS10055 | 1844824..1845180 | + | 357 | WP_001302146.1 | hypothetical protein | - |
A8V31_RS10060 | 1845229..1845441 | + | 213 | WP_000063625.1 | hypothetical protein | - |
A8V31_RS10065 | 1845477..1845848 | + | 372 | WP_000137941.1 | hypothetical protein | - |
A8V31_RS10070 | 1845845..1846207 | + | 363 | WP_000610379.1 | DUF551 domain-containing protein | - |
A8V31_RS10075 | 1846323..1846427 | + | 105 | WP_001278450.1 | hypothetical protein | - |
- | 1846603..1846661 | - | 59 | - | - | Antitoxin |
A8V31_RS10085 | 1846673..1846828 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
A8V31_RS31280 | 1847125..1847292 | + | 168 | WP_000998188.1 | hypothetical protein | - |
A8V31_RS10090 | 1847358..1847636 | + | 279 | WP_001304183.1 | hypothetical protein | - |
A8V31_RS10095 | 1847638..1848687 | + | 1050 | Protein_1823 | DUF968 domain-containing protein | - |
A8V31_RS10100 | 1848700..1849074 | + | 375 | WP_000904137.1 | RusA family crossover junction endodeoxyribonuclease | - |
A8V31_RS10105 | 1849071..1849892 | + | 822 | WP_000762904.1 | antitermination protein | - |
A8V31_RS10110 | 1850119..1850316 | + | 198 | WP_000917735.1 | hypothetical protein | - |
A8V31_RS10115 | 1850467..1851525 | + | 1059 | WP_000483497.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | paa / nleA/espI / espM1 | 1772890..1889738 | 116848 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T63655 WP_000813254.1 NZ_CP015842:1846673-1846828 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T63655 NZ_CP015842:1846673-1846828 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT63655 NZ_CP015842:c1846661-1846603 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|