Detailed information of TA system TA063653

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 1735061..1735275
• Replicon: chromosome
• Accession: NZ_CP015842
• Organism: Escherichia coli O157:H7 strain FRIK2533

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: A8V31_RS09380
• Protein ID: WP_000170963.1
• Coordinates: 1735061..1735168 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	1735216..1735275 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
A8V31_RS09350	1730370..1731452	+	1083	WP_000804726.1	peptide chain release factor 1	-
A8V31_RS09355	1731452..1732285	+	834	WP_000456466.1	peptide chain release factor N(5)-glutamine methyltransferase	-
A8V31_RS09360	1732282..1732674	+	393	WP_000200379.1	invasion regulator SirB2	-
A8V31_RS09365	1732678..1733487	+	810	WP_001257044.1	invasion regulator SirB1	-
A8V31_RS09370	1733523..1734377	+	855	WP_000811067.1	3-deoxy-8-phosphooctulonate synthase	-
A8V31_RS09375	1734525..1734632	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	1734685..1734746	+	62	NuclAT_24	-	-
-	1734685..1734746	+	62	NuclAT_24	-	-
-	1734685..1734746	+	62	NuclAT_24	-	-
-	1734685..1734746	+	62	NuclAT_24	-	-
-	1734685..1734746	+	62	NuclAT_26	-	-
-	1734685..1734746	+	62	NuclAT_26	-	-
-	1734685..1734746	+	62	NuclAT_26	-	-
-	1734685..1734746	+	62	NuclAT_26	-	-
-	1734685..1734746	+	62	NuclAT_28	-	-
-	1734685..1734746	+	62	NuclAT_28	-	-
-	1734685..1734746	+	62	NuclAT_28	-	-
-	1734685..1734746	+	62	NuclAT_28	-	-
-	1734685..1734746	+	62	NuclAT_30	-	-
-	1734685..1734746	+	62	NuclAT_30	-	-
-	1734685..1734746	+	62	NuclAT_30	-	-
-	1734685..1734746	+	62	NuclAT_30	-	-
-	1734685..1734746	+	62	NuclAT_32	-	-
-	1734685..1734746	+	62	NuclAT_32	-	-
-	1734685..1734746	+	62	NuclAT_32	-	-
-	1734685..1734746	+	62	NuclAT_32	-	-
-	1734685..1734747	+	63	NuclAT_17	-	-
-	1734685..1734747	+	63	NuclAT_17	-	-
-	1734685..1734747	+	63	NuclAT_17	-	-
-	1734685..1734747	+	63	NuclAT_17	-	-
-	1734685..1734747	+	63	NuclAT_18	-	-
-	1734685..1734747	+	63	NuclAT_18	-	-
-	1734685..1734747	+	63	NuclAT_18	-	-
-	1734685..1734747	+	63	NuclAT_18	-	-
-	1734685..1734747	+	63	NuclAT_19	-	-
-	1734685..1734747	+	63	NuclAT_19	-	-
-	1734685..1734747	+	63	NuclAT_19	-	-
-	1734685..1734747	+	63	NuclAT_19	-	-
-	1734685..1734747	+	63	NuclAT_20	-	-
-	1734685..1734747	+	63	NuclAT_20	-	-
-	1734685..1734747	+	63	NuclAT_20	-	-
-	1734685..1734747	+	63	NuclAT_20	-	-
-	1734685..1734747	+	63	NuclAT_22	-	-
-	1734685..1734747	+	63	NuclAT_22	-	-
-	1734685..1734747	+	63	NuclAT_22	-	-
-	1734685..1734747	+	63	NuclAT_22	-	-
-	1734685..1734747	+	63	NuclAT_23	-	-
-	1734685..1734747	+	63	NuclAT_23	-	-
-	1734685..1734747	+	63	NuclAT_23	-	-
-	1734685..1734747	+	63	NuclAT_23	-	-
A8V31_RS09380	1735061..1735168	-	108	WP_000170963.1	small toxic polypeptide LdrB	Toxin
-	1735216..1735275	+	60	NuclAT_25	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_25	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_25	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_25	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_27	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_27	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_27	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_27	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_29	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_29	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_29	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_29	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_31	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_31	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_31	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_31	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_33	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_33	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_33	-	Antitoxin
-	1735216..1735275	+	60	NuclAT_33	-	Antitoxin
A8V31_RS09385	1735567..1736667	-	1101	WP_001301956.1	sodium-potassium/proton antiporter ChaA	-
A8V31_RS09390	1736937..1737167	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
A8V31_RS09395	1737328..1738023	+	696	WP_001301489.1	glutathione-specific gamma-glutamylcyclotransferase	-
A8V31_RS09400	1738067..1738420	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
A8V31_RS09405	1738606..1740000	+	1395	WP_000086192.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T63653 WP_000170963.1 NZ_CP015842:c1735168-1735061 [Escherichia coli O157:H7]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T63653 NZ_CP015842:c1735168-1735061 [Escherichia coli O157:H7]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT63653 NZ_CP015842:1735216-1735275 [Escherichia coli O157:H7]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin