Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1279974..1280199 | Replicon | chromosome |
Accession | NZ_CP015842 | ||
Organism | Escherichia coli O157:H7 strain FRIK2533 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | A8V31_RS06585 | Protein ID | WP_000813263.1 |
Coordinates | 1280044..1280199 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1279974..1280032 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A8V31_RS06560 | 1275249..1276340 | + | 1092 | WP_001205823.1 | hypothetical protein | - |
A8V31_RS06565 | 1276347..1277093 | + | 747 | WP_000788751.1 | ATP-binding protein | - |
A8V31_RS06570 | 1277115..1277885 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
A8V31_RS06575 | 1277901..1278314 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
A8V31_RS06580 | 1278666..1279439 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
- | 1279974..1280032 | - | 59 | - | - | Antitoxin |
A8V31_RS06585 | 1280044..1280199 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
A8V31_RS06590 | 1280367..1280645 | + | 279 | WP_001341388.1 | hypothetical protein | - |
A8V31_RS06595 | 1280647..1281696 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
A8V31_RS06600 | 1281709..1282080 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
A8V31_RS06605 | 1282070..1282441 | + | 372 | WP_000090264.1 | antitermination protein | - |
A8V31_RS06610 | 1282593..1283411 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
A8V31_RS06615 | 1283698..1283894 | + | 197 | Protein_1197 | TrmB family transcriptional regulator | - |
A8V31_RS30695 | 1284032..1284745 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T63650 WP_000813263.1 NZ_CP015842:1280044-1280199 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T63650 NZ_CP015842:1280044-1280199 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT63650 NZ_CP015842:c1280032-1279974 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|