Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2794701..2794915 Replicon chromosome
Accession NZ_CP015831
Organism Escherichia coli O157 strain 644-PT8

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag A8L40_RS14660 Protein ID WP_000170963.1
Coordinates 2794701..2794808 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2794856..2794915 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A8L40_RS14630 2790008..2791091 + 1084 Protein_2789 peptide chain release factor 1 -
A8L40_RS14635 2791091..2791924 + 834 WP_064236378.1 peptide chain release factor N(5)-glutamine methyltransferase -
A8L40_RS14640 2791921..2792313 + 393 WP_000200379.1 invasion regulator SirB2 -
A8L40_RS14645 2792317..2793127 + 811 Protein_2792 invasion regulator SirB1 -
A8L40_RS14650 2793163..2794017 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
A8L40_RS14655 2794165..2794272 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2794325..2794386 + 62 NuclAT_31 - -
- 2794325..2794386 + 62 NuclAT_31 - -
- 2794325..2794386 + 62 NuclAT_31 - -
- 2794325..2794386 + 62 NuclAT_31 - -
- 2794325..2794386 + 62 NuclAT_35 - -
- 2794325..2794386 + 62 NuclAT_35 - -
- 2794325..2794386 + 62 NuclAT_35 - -
- 2794325..2794386 + 62 NuclAT_35 - -
- 2794325..2794386 + 62 NuclAT_39 - -
- 2794325..2794386 + 62 NuclAT_39 - -
- 2794325..2794386 + 62 NuclAT_39 - -
- 2794325..2794386 + 62 NuclAT_39 - -
- 2794325..2794386 + 62 NuclAT_43 - -
- 2794325..2794386 + 62 NuclAT_43 - -
- 2794325..2794386 + 62 NuclAT_43 - -
- 2794325..2794386 + 62 NuclAT_43 - -
- 2794325..2794386 + 62 NuclAT_47 - -
- 2794325..2794386 + 62 NuclAT_47 - -
- 2794325..2794386 + 62 NuclAT_47 - -
- 2794325..2794386 + 62 NuclAT_47 - -
- 2794325..2794387 + 63 NuclAT_18 - -
- 2794325..2794387 + 63 NuclAT_18 - -
- 2794325..2794387 + 63 NuclAT_18 - -
- 2794325..2794387 + 63 NuclAT_18 - -
- 2794325..2794387 + 63 NuclAT_20 - -
- 2794325..2794387 + 63 NuclAT_20 - -
- 2794325..2794387 + 63 NuclAT_20 - -
- 2794325..2794387 + 63 NuclAT_20 - -
- 2794325..2794387 + 63 NuclAT_22 - -
- 2794325..2794387 + 63 NuclAT_22 - -
- 2794325..2794387 + 63 NuclAT_22 - -
- 2794325..2794387 + 63 NuclAT_22 - -
- 2794325..2794387 + 63 NuclAT_24 - -
- 2794325..2794387 + 63 NuclAT_24 - -
- 2794325..2794387 + 63 NuclAT_24 - -
- 2794325..2794387 + 63 NuclAT_24 - -
- 2794325..2794387 + 63 NuclAT_27 - -
- 2794325..2794387 + 63 NuclAT_27 - -
- 2794325..2794387 + 63 NuclAT_27 - -
- 2794325..2794387 + 63 NuclAT_27 - -
- 2794325..2794387 + 63 NuclAT_29 - -
- 2794325..2794387 + 63 NuclAT_29 - -
- 2794325..2794387 + 63 NuclAT_29 - -
- 2794325..2794387 + 63 NuclAT_29 - -
A8L40_RS14660 2794701..2794808 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 2794856..2794915 + 60 NuclAT_33 - Antitoxin
- 2794856..2794915 + 60 NuclAT_33 - Antitoxin
- 2794856..2794915 + 60 NuclAT_33 - Antitoxin
- 2794856..2794915 + 60 NuclAT_33 - Antitoxin
- 2794856..2794915 + 60 NuclAT_37 - Antitoxin
- 2794856..2794915 + 60 NuclAT_37 - Antitoxin
- 2794856..2794915 + 60 NuclAT_37 - Antitoxin
- 2794856..2794915 + 60 NuclAT_37 - Antitoxin
- 2794856..2794915 + 60 NuclAT_41 - Antitoxin
- 2794856..2794915 + 60 NuclAT_41 - Antitoxin
- 2794856..2794915 + 60 NuclAT_41 - Antitoxin
- 2794856..2794915 + 60 NuclAT_41 - Antitoxin
- 2794856..2794915 + 60 NuclAT_45 - Antitoxin
- 2794856..2794915 + 60 NuclAT_45 - Antitoxin
- 2794856..2794915 + 60 NuclAT_45 - Antitoxin
- 2794856..2794915 + 60 NuclAT_45 - Antitoxin
- 2794856..2794915 + 60 NuclAT_49 - Antitoxin
- 2794856..2794915 + 60 NuclAT_49 - Antitoxin
- 2794856..2794915 + 60 NuclAT_49 - Antitoxin
- 2794856..2794915 + 60 NuclAT_49 - Antitoxin
A8L40_RS14665 2795207..2796307 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
A8L40_RS14670 2796577..2796807 + 231 WP_001146444.1 putative cation transport regulator ChaB -
A8L40_RS14675 2796968..2797663 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
A8L40_RS14680 2797707..2798060 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
A8L40_RS14685 2798246..2799640 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T63537 WP_000170963.1 NZ_CP015831:c2794808-2794701 [Escherichia coli O157]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T63537 NZ_CP015831:c2794808-2794701 [Escherichia coli O157]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT63537 NZ_CP015831:2794856-2794915 [Escherichia coli O157]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References