Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2487626..2487810 | Replicon | chromosome |
Accession | NZ_CP015817 | ||
Organism | Staphylococcus aureus strain FORC_039 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | FORC39_RS13010 | Protein ID | WP_072467491.1 |
Coordinates | 2487703..2487810 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2487626..2487686 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FORC39_RS12985 | 2483194..2483361 | - | 168 | WP_031866196.1 | hypothetical protein | - |
FORC39_RS12995 | 2483592..2485325 | - | 1734 | WP_000486502.1 | ABC transporter ATP-binding protein/permease | - |
FORC39_RS13000 | 2485350..2487113 | - | 1764 | WP_001064834.1 | ABC transporter ATP-binding protein/permease | - |
- | 2487626..2487686 | + | 61 | - | - | Antitoxin |
FORC39_RS13010 | 2487703..2487810 | - | 108 | WP_072467491.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
FORC39_RS13015 | 2487944..2488330 | - | 387 | WP_000779348.1 | flippase GtxA | - |
FORC39_RS13020 | 2488587..2489729 | + | 1143 | WP_001176873.1 | glycerate kinase | - |
FORC39_RS13025 | 2489789..2490448 | + | 660 | WP_000831298.1 | membrane protein | - |
FORC39_RS13030 | 2490630..2491841 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
FORC39_RS13035 | 2491964..2492437 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3944.67 Da Isoelectric Point: 10.4934
>T63494 WP_072467491.1 NZ_CP015817:c2487810-2487703 [Staphylococcus aureus]
IFNLLIDIMTSAISGCLVAFFANWLRTRSNKKGDK
IFNLLIDIMTSAISGCLVAFFANWLRTRSNKKGDK
Download Length: 108 bp
>T63494 NZ_CP015817:c2487810-2487703 [Staphylococcus aureus]
ATCTTCAATTTATTAATTGACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCAAATTGGTTACGAAC
GCGCAGCAATAAAAAAGGTGACAAATAA
ATCTTCAATTTATTAATTGACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCAAATTGGTTACGAAC
GCGCAGCAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT63494 NZ_CP015817:2487626-2487686 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|