Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2209268..2209484 | Replicon | chromosome |
Accession | NZ_CP015817 | ||
Organism | Staphylococcus aureus strain FORC_039 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | FORC39_RS11470 | Protein ID | WP_001802298.1 |
Coordinates | 2209380..2209484 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2209268..2209323 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FORC39_RS11450 | 2205462..2206127 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
FORC39_RS11455 | 2206279..2206599 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
FORC39_RS11460 | 2206601..2207581 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
FORC39_RS11465 | 2207847..2208938 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
- | 2209268..2209323 | + | 56 | - | - | Antitoxin |
FORC39_RS11470 | 2209380..2209484 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
FORC39_RS11480 | 2210164..2210322 | + | 159 | WP_001792784.1 | hypothetical protein | - |
FORC39_RS11490 | 2210980..2211837 | - | 858 | WP_000370928.1 | Cof-type HAD-IIB family hydrolase | - |
FORC39_RS11495 | 2211905..2212687 | - | 783 | WP_000908189.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T63491 WP_001802298.1 NZ_CP015817:c2209484-2209380 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T63491 NZ_CP015817:c2209484-2209380 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT63491 NZ_CP015817:2209268-2209323 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|