Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1063382..1063562 | Replicon | chromosome |
| Accession | NZ_CP015817 | ||
| Organism | Staphylococcus aureus strain FORC_039 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | FORC39_RS14750 | Protein ID | WP_001801861.1 |
| Coordinates | 1063467..1063562 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1063382..1063439 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FORC39_RS05655 | 1059733..1060851 | + | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
| FORC39_RS05660 | 1061499..1061942 | + | 444 | WP_000742594.1 | DUF1433 domain-containing protein | - |
| FORC39_RS05665 | 1062152..1062499 | + | 348 | WP_001566695.1 | DUF1433 domain-containing protein | - |
| FORC39_RS05670 | 1062521..1062895 | + | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
| FORC39_RS05675 | 1063083..1063265 | + | 183 | Protein_1024 | transposase | - |
| FORC39_RS05680 | 1063243..1063344 | - | 102 | WP_001791232.1 | hypothetical protein | - |
| - | 1063382..1063439 | + | 58 | - | - | Antitoxin |
| FORC39_RS14750 | 1063467..1063562 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| FORC39_RS05690 | 1064013..1064459 | + | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
| FORC39_RS05695 | 1065144..1065527 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| FORC39_RS05700 | 1065538..1065714 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| FORC39_RS05710 | 1066085..1066642 | + | 558 | WP_000864138.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FORC39_RS14820 | 1066840..1067412 | - | 573 | Protein_1031 | hypothetical protein | - |
| FORC39_RS05715 | 1067513..1067854 | - | 342 | WP_049311638.1 | DUF3969 family protein | - |
| FORC39_RS05720 | 1067895..1068521 | - | 627 | WP_000669019.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hlgA / lukD | 1043589..1089379 | 45790 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T63486 WP_001801861.1 NZ_CP015817:c1063562-1063467 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T63486 NZ_CP015817:c1063562-1063467 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT63486 NZ_CP015817:1063382-1063439 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|