Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2289519..2289736 | Replicon | chromosome |
Accession | NZ_CP015646 | ||
Organism | Staphylococcus aureus strain 08-02300 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | A7327_RS11475 | Protein ID | WP_001802298.1 |
Coordinates | 2289632..2289736 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2289519..2289574 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A7327_RS11455 | 2285713..2286378 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
A7327_RS11460 | 2286530..2286850 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
A7327_RS11465 | 2286852..2287835 | + | 984 | WP_064626830.1 | CDF family zinc efflux transporter CzrB | - |
A7327_RS11470 | 2288098..2289189 | + | 1092 | WP_000495683.1 | hypothetical protein | - |
- | 2289519..2289574 | + | 56 | - | - | Antitoxin |
A7327_RS11475 | 2289632..2289736 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
A7327_RS14545 | 2289897..2290380 | - | 484 | Protein_2169 | recombinase family protein | - |
A7327_RS11485 | 2290423..2291559 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
A7327_RS11490 | 2291848..2291940 | + | 93 | WP_001790138.1 | hypothetical protein | - |
A7327_RS11495 | 2292645..2293502 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
A7327_RS11500 | 2293570..2294352 | - | 783 | WP_000908177.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T63312 WP_001802298.1 NZ_CP015646:c2289736-2289632 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T63312 NZ_CP015646:c2289736-2289632 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT63312 NZ_CP015646:2289519-2289574 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|