Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 27698..27846 | Replicon | plasmid pl21596-1 |
Accession | NZ_CP015554 | ||
Organism | Staphylococcus carnosus strain TMW 2.1596 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | A2I68_RS13235 | Protein ID | WP_011276848.1 |
Coordinates | 27698..27793 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 27811..27846 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A2I68_RS13205 (23772) | 23772..24764 | + | 993 | WP_046100644.1 | replication initiator protein A | - |
A2I68_RS13210 (24803) | 24803..24976 | + | 174 | WP_046100645.1 | protein rep | - |
A2I68_RS13215 (25687) | 25687..25857 | + | 171 | WP_160149154.1 | hypothetical protein | - |
A2I68_RS13220 (25879) | 25879..26307 | + | 429 | WP_046100646.1 | Hsp20/alpha crystallin family protein | - |
A2I68_RS13225 (26612) | 26612..26809 | + | 198 | WP_039069675.1 | helix-turn-helix transcriptional regulator | - |
A2I68_RS13230 (26829) | 26829..27371 | + | 543 | WP_082080603.1 | peptide deformylase | - |
A2I68_RS13235 (27698) | 27698..27793 | + | 96 | WP_011276848.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- (27811) | 27811..27846 | + | 36 | NuclAT_0 | - | Antitoxin |
- (27811) | 27811..27846 | + | 36 | NuclAT_0 | - | Antitoxin |
- (27811) | 27811..27846 | + | 36 | NuclAT_0 | - | Antitoxin |
A2I68_RS13240 (28053) | 28053..28385 | - | 333 | WP_046100648.1 | hypothetical protein | - |
A2I68_RS13245 (28327) | 28327..29811 | - | 1485 | WP_052719494.1 | retron Ec67 family RNA-directed DNA polymerase/endonuclease | - |
A2I68_RS13250 (30059) | 30059..30667 | + | 609 | WP_046100649.1 | recombinase family protein | - |
A2I68_RS13255 (31036) | 31036..32811 | + | 1776 | WP_046100650.1 | oleate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T63185 WP_011276848.1 NZ_CP015554:27698-27793 [Staphylococcus carnosus]
MLEILVHITTTVISGCIIALFTHWLRNRKDK
MLEILVHITTTVISGCIIALFTHWLRNRKDK
Download Length: 96 bp
>T63185 NZ_CP015554:27698-27793 [Staphylococcus carnosus]
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
Antitoxin
Download Length: 36 bp
>AT63185 NZ_CP015554:27811-27846 [Staphylococcus carnosus]
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|