Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2255..2525 | Replicon | plasmid unnamed 3 |
| Accession | NZ_CP015503 | ||
| Organism | Klebsiella pneumoniae strain SKGH01 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | A7B01_RS31865 | Protein ID | WP_001312861.1 |
| Coordinates | 2367..2525 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 2255..2318 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7B01_RS29225 | 937..1371 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| A7B01_RS29230 | 1368..2087 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 2099..2323 | + | 225 | NuclAT_0 | - | - |
| - | 2099..2323 | + | 225 | NuclAT_0 | - | - |
| - | 2099..2323 | + | 225 | NuclAT_0 | - | - |
| - | 2099..2323 | + | 225 | NuclAT_0 | - | - |
| - | 2255..2318 | - | 64 | - | - | Antitoxin |
| A7B01_RS31865 | 2367..2525 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| A7B01_RS33755 | 2763..3140 | - | 378 | Protein_4 | hypothetical protein | - |
| A7B01_RS29240 | 3440..3736 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| A7B01_RS29245 | 3847..4668 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| A7B01_RS29250 | 4965..5567 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| A7B01_RS29255 | 5890..6273 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
| A7B01_RS29260 | 6467..7138 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| A7B01_RS29265 | 7275..7502 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtF / aadA2 / dfrA12 | - | 1..84941 | 84941 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T63136 WP_001312861.1 NZ_CP015503:2367-2525 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T63136 NZ_CP015503:2367-2525 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT63136 NZ_CP015503:c2318-2255 [Klebsiella pneumoniae]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|