Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2112138..2112437 | Replicon | chromosome |
Accession | NZ_CP015447 | ||
Organism | Staphylococcus aureus strain M92 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | A6V38_RS11050 | Protein ID | WP_072353918.1 |
Coordinates | 2112261..2112437 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2112138..2112193 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A6V38_RS10995 | 2107167..2107517 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
A6V38_RS11005 | 2107689..2108861 | + | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
A6V38_RS11010 | 2109360..2109695 | - | 336 | Protein_2028 | SH3 domain-containing protein | - |
A6V38_RS11030 | 2110346..2110837 | - | 492 | WP_000920038.1 | staphylokinase | - |
A6V38_RS11035 | 2111028..2111783 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
A6V38_RS11040 | 2111795..2112049 | - | 255 | WP_000611512.1 | phage holin | - |
A6V38_RS11045 | 2112101..2112208 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2112130..2112269 | + | 140 | NuclAT_0 | - | - |
- | 2112130..2112269 | + | 140 | NuclAT_0 | - | - |
- | 2112130..2112269 | + | 140 | NuclAT_0 | - | - |
- | 2112130..2112269 | + | 140 | NuclAT_0 | - | - |
- | 2112138..2112193 | + | 56 | - | - | Antitoxin |
A6V38_RS11050 | 2112261..2112437 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
A6V38_RS11055 | 2112580..2112954 | - | 375 | WP_000340977.1 | hypothetical protein | - |
A6V38_RS11060 | 2113010..2113297 | - | 288 | WP_001262620.1 | hypothetical protein | - |
A6V38_RS11065 | 2113343..2113495 | - | 153 | WP_001000058.1 | hypothetical protein | - |
A6V38_RS11070 | 2113488..2117270 | - | 3783 | WP_000582132.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 2107167..2166875 | 59708 | |
- | flank | IS/Tn | - | - | 2107689..2108861 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T63082 WP_072353918.1 NZ_CP015447:c2112437-2112261 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T63082 NZ_CP015447:c2112437-2112261 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT63082 NZ_CP015447:2112138-2112193 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|