Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 2680990..2681205 | Replicon | chromosome |
Accession | NZ_CP015410 | ||
Organism | Enterococcus faecalis strain KB1 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | A4V06_RS13135 | Protein ID | WP_002360667.1 |
Coordinates | 2681095..2681205 (-) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2680990..2681054 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A4V06_RS13120 | 2676619..2676894 | - | 276 | WP_065536085.1 | type III secretion system protein PrgN | - |
A4V06_RS13125 | 2676948..2677553 | - | 606 | WP_000238804.1 | recombinase family protein | - |
A4V06_RS13130 | 2677684..2680656 | + | 2973 | WP_000653331.1 | Tn3 family transposase | - |
- | 2680990..2681054 | + | 65 | - | - | Antitoxin |
A4V06_RS13135 | 2681095..2681205 | - | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
A4V06_RS13145 | 2681456..2681806 | - | 351 | WP_010824125.1 | hypothetical protein | - |
A4V06_RS13150 | 2681803..2683131 | - | 1329 | WP_002370254.1 | Y-family DNA polymerase | - |
A4V06_RS13155 | 2683560..2683862 | - | 303 | WP_002406176.1 | hypothetical protein | - |
A4V06_RS13160 | 2683874..2684083 | - | 210 | WP_010822384.1 | hypothetical protein | - |
A4V06_RS13165 | 2684144..2684368 | - | 225 | WP_002406593.1 | hypothetical protein | - |
A4V06_RS13170 | 2684362..2684676 | - | 315 | WP_025188489.1 | hypothetical protein | - |
A4V06_RS13175 | 2684666..2685286 | - | 621 | WP_025188285.1 | recombinase family protein | - |
A4V06_RS13180 | 2685489..2685803 | - | 315 | WP_002401837.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2667127..2708128 | 41001 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T63056 WP_002360667.1 NZ_CP015410:c2681205-2681095 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
>T63056 NZ_CP015410:c2681205-2681095 [Enterococcus faecalis]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
Antitoxin
Download Length: 65 bp
>AT63056 NZ_CP015410:2680990-2681054 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|