Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 1013445..1013648 | Replicon | chromosome |
Accession | NZ_CP015410 | ||
Organism | Enterococcus faecalis strain KB1 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | A4V06_RS04955 | Protein ID | WP_157734666.1 |
Coordinates | 1013544..1013648 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 1013445..1013509 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A4V06_RS04940 | 1009057..1010805 | + | 1749 | WP_002393697.1 | PTS transporter subunit EIIC | - |
A4V06_RS04945 | 1010796..1012829 | + | 2034 | WP_002361171.1 | transcription antiterminator | - |
A4V06_RS04950 | 1012840..1013274 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 1013445..1013509 | + | 65 | - | - | Antitoxin |
A4V06_RS04955 | 1013544..1013648 | - | 105 | WP_157734666.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
A4V06_RS04960 | 1013885..1015657 | + | 1773 | WP_065535975.1 | PTS mannitol transporter subunit IICBA | - |
A4V06_RS04965 | 1015672..1016109 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
A4V06_RS04970 | 1016124..1017278 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
A4V06_RS04975 | 1017345..1018460 | - | 1116 | WP_002380024.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 4014.85 Da Isoelectric Point: 6.4459
>T63051 WP_157734666.1 NZ_CP015410:c1013648-1013544 [Enterococcus faecalis]
VHHIYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
VHHIYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 105 bp
>T63051 NZ_CP015410:c1013648-1013544 [Enterococcus faecalis]
GTGCATCACATATACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTG
GTTGGAAAAACAGAACGAGGAATAA
GTGCATCACATATACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTG
GTTGGAAAAACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT63051 NZ_CP015410:1013445-1013509 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|