Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 44428..44698 | Replicon | plasmid pNY9_3 |
Accession | NZ_CP015388 | ||
Organism | Klebsiella pneumoniae strain NY9 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | A6P56_RS34210 | Protein ID | WP_001312861.1 |
Coordinates | 44540..44698 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 44428..44491 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A6P56_RS30625 | 40139..40666 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
A6P56_RS30630 | 40724..40957 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
A6P56_RS30635 | 41018..43041 | + | 2024 | Protein_48 | ParB/RepB/Spo0J family partition protein | - |
A6P56_RS30640 | 43110..43544 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
A6P56_RS30645 | 43541..44260 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 44272..44496 | + | 225 | NuclAT_0 | - | - |
- | 44272..44496 | + | 225 | NuclAT_0 | - | - |
- | 44272..44496 | + | 225 | NuclAT_0 | - | - |
- | 44272..44496 | + | 225 | NuclAT_0 | - | - |
- | 44428..44491 | - | 64 | - | - | Antitoxin |
A6P56_RS34210 | 44540..44698 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
A6P56_RS30655 | 45056..45481 | + | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
A6P56_RS30660 | 45478..45828 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
A6P56_RS30665 | 45859..47472 | + | 1614 | WP_000080200.1 | IS66-like element ISEc23 family transposase | - |
A6P56_RS34445 | 47557..47761 | - | 205 | Protein_55 | pilus protein | - |
A6P56_RS30685 | 48153..48449 | + | 297 | WP_001272251.1 | hypothetical protein | - |
A6P56_RS30690 | 48560..49381 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / blaTEM-1B | - | 1..89067 | 89067 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T63011 WP_001312861.1 NZ_CP015388:44540-44698 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T63011 NZ_CP015388:44540-44698 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT63011 NZ_CP015388:c44491-44428 [Klebsiella pneumoniae]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|