Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 51403..51657 | Replicon | plasmid unnamed1 |
Accession | NZ_CP015239 | ||
Organism | Escherichia coli strain 2011C-3911 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | - |
Locus tag | A5956_RS00210 | Protein ID | WP_032211975.1 |
Coordinates | 51403..51609 (-) | Length | 69 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 51601..51657 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A5956_RS00180 | 47061..47810 | - | 750 | Protein_35 | ISKra4-like element ISEc51 family transposase | - |
A5956_RS24790 | 47810..48148 | + | 339 | Protein_36 | Tn3 family transposase | - |
A5956_RS24795 | 48487..48726 | - | 240 | WP_071978018.1 | MarR family transcriptional regulator | - |
A5956_RS26460 | 48739..48999 | - | 261 | WP_072148071.1 | hypothetical protein | - |
A5956_RS00195 | 49702..50559 | - | 858 | WP_064055973.1 | incFII family plasmid replication initiator RepA | - |
A5956_RS00200 | 50552..50626 | - | 75 | WP_001365571.1 | RepA leader peptide Tap | - |
A5956_RS00205 | 50862..51119 | - | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
A5956_RS00210 | 51403..51609 | - | 207 | WP_032211975.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 51601..51657 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 51601..51657 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 51601..51657 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 51601..51657 | + | 57 | NuclAT_1 | - | Antitoxin |
A5956_RS00215 | 51832..52215 | - | 384 | WP_028985877.1 | hypothetical protein | - |
A5956_RS00220 | 52318..52779 | - | 462 | WP_000760076.1 | thermonuclease family protein | - |
A5956_RS00230 | 53880..54437 | - | 558 | WP_028985878.1 | fertility inhibition protein FinO | - |
A5956_RS00235 | 54473..54841 | - | 369 | WP_000722534.1 | NirD/YgiW/YdeI family stress tolerance protein | - |
A5956_RS00240 | 54924..55670 | - | 747 | WP_028985879.1 | type-F conjugative transfer system pilin acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..125977 | 125977 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7836.33 Da Isoelectric Point: 9.2439
>T62702 WP_032211975.1 NZ_CP015239:c51609-51403 [Escherichia coli]
MKYLNTTDCSLFLAERSKFMTKYALIGLLAVCATVLFFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFLAERSKFMTKYALIGLLAVCATVLFFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
>T62702 NZ_CP015239:c51609-51403 [Escherichia coli]
ATGAAGTACTTGAACACTACTGATTGTAGCCTCTTCCTTGCAGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTTTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGGG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGAAGTACTTGAACACTACTGATTGTAGCCTCTTCCTTGCAGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTTTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGGG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 57 bp
>AT62702 NZ_CP015239:51601-51657 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|