Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1524460..1524682 | Replicon | chromosome |
| Accession | NZ_CP015229 | ||
| Organism | Escherichia coli strain 06-00048 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A229AEQ8 |
| Locus tag | GJ11_RS09290 | Protein ID | WP_000176713.1 |
| Coordinates | 1524460..1524567 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1524619..1524682 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GJ11_RS09265 | 1520305..1521387 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| GJ11_RS09270 | 1521387..1522220 | + | 834 | WP_065226676.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| GJ11_RS09275 | 1522217..1522609 | + | 393 | WP_065226677.1 | invasion regulator SirB2 | - |
| GJ11_RS09280 | 1522613..1523422 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| GJ11_RS09285 | 1523458..1524312 | + | 855 | WP_061348474.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| GJ11_RS09290 | 1524460..1524567 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1524619..1524682 | + | 64 | NuclAT_11 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_11 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_11 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_11 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_13 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_13 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_13 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_13 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_15 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_15 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_15 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_15 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_17 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_17 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_17 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_17 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_19 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_19 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_19 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_19 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_21 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_21 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_21 | - | Antitoxin |
| - | 1524619..1524682 | + | 64 | NuclAT_21 | - | Antitoxin |
| GJ11_RS09295 | 1524995..1525102 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | - |
| - | 1525150..1525215 | + | 66 | NuclAT_23 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_23 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_23 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_23 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_24 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_24 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_24 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_24 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_25 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_25 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_25 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_25 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_26 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_26 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_26 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_26 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_27 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_27 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_27 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_27 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_28 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_28 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_28 | - | - |
| - | 1525150..1525215 | + | 66 | NuclAT_28 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_10 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_10 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_10 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_10 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_12 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_12 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_12 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_12 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_14 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_14 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_14 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_14 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_16 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_16 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_16 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_16 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_18 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_18 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_18 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_18 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_20 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_20 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_20 | - | - |
| - | 1525150..1525217 | + | 68 | NuclAT_20 | - | - |
| GJ11_RS09300 | 1525507..1526607 | - | 1101 | WP_001306585.1 | sodium-potassium/proton antiporter ChaA | - |
| GJ11_RS09305 | 1526877..1527107 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| GJ11_RS09310 | 1527265..1527960 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| GJ11_RS09315 | 1528004..1528357 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T62674 WP_000176713.1 NZ_CP015229:c1524567-1524460 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T62674 NZ_CP015229:c1524567-1524460 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 64 bp
>AT62674 NZ_CP015229:1524619-1524682 [Escherichia coli]
TGGTTCAAGATTAACCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTCT
TGGTTCAAGATTAACCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|