Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1524460..1524682 Replicon chromosome
Accession NZ_CP015229
Organism Escherichia coli strain 06-00048

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag GJ11_RS09290 Protein ID WP_000176713.1
Coordinates 1524460..1524567 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1524619..1524682 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GJ11_RS09265 1520305..1521387 + 1083 WP_000804726.1 peptide chain release factor 1 -
GJ11_RS09270 1521387..1522220 + 834 WP_065226676.1 peptide chain release factor N(5)-glutamine methyltransferase -
GJ11_RS09275 1522217..1522609 + 393 WP_065226677.1 invasion regulator SirB2 -
GJ11_RS09280 1522613..1523422 + 810 WP_001257044.1 invasion regulator SirB1 -
GJ11_RS09285 1523458..1524312 + 855 WP_061348474.1 3-deoxy-8-phosphooctulonate synthase -
GJ11_RS09290 1524460..1524567 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1524619..1524682 + 64 NuclAT_11 - Antitoxin
- 1524619..1524682 + 64 NuclAT_11 - Antitoxin
- 1524619..1524682 + 64 NuclAT_11 - Antitoxin
- 1524619..1524682 + 64 NuclAT_11 - Antitoxin
- 1524619..1524682 + 64 NuclAT_13 - Antitoxin
- 1524619..1524682 + 64 NuclAT_13 - Antitoxin
- 1524619..1524682 + 64 NuclAT_13 - Antitoxin
- 1524619..1524682 + 64 NuclAT_13 - Antitoxin
- 1524619..1524682 + 64 NuclAT_15 - Antitoxin
- 1524619..1524682 + 64 NuclAT_15 - Antitoxin
- 1524619..1524682 + 64 NuclAT_15 - Antitoxin
- 1524619..1524682 + 64 NuclAT_15 - Antitoxin
- 1524619..1524682 + 64 NuclAT_17 - Antitoxin
- 1524619..1524682 + 64 NuclAT_17 - Antitoxin
- 1524619..1524682 + 64 NuclAT_17 - Antitoxin
- 1524619..1524682 + 64 NuclAT_17 - Antitoxin
- 1524619..1524682 + 64 NuclAT_19 - Antitoxin
- 1524619..1524682 + 64 NuclAT_19 - Antitoxin
- 1524619..1524682 + 64 NuclAT_19 - Antitoxin
- 1524619..1524682 + 64 NuclAT_19 - Antitoxin
- 1524619..1524682 + 64 NuclAT_21 - Antitoxin
- 1524619..1524682 + 64 NuclAT_21 - Antitoxin
- 1524619..1524682 + 64 NuclAT_21 - Antitoxin
- 1524619..1524682 + 64 NuclAT_21 - Antitoxin
GJ11_RS09295 1524995..1525102 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1525150..1525215 + 66 NuclAT_23 - -
- 1525150..1525215 + 66 NuclAT_23 - -
- 1525150..1525215 + 66 NuclAT_23 - -
- 1525150..1525215 + 66 NuclAT_23 - -
- 1525150..1525215 + 66 NuclAT_24 - -
- 1525150..1525215 + 66 NuclAT_24 - -
- 1525150..1525215 + 66 NuclAT_24 - -
- 1525150..1525215 + 66 NuclAT_24 - -
- 1525150..1525215 + 66 NuclAT_25 - -
- 1525150..1525215 + 66 NuclAT_25 - -
- 1525150..1525215 + 66 NuclAT_25 - -
- 1525150..1525215 + 66 NuclAT_25 - -
- 1525150..1525215 + 66 NuclAT_26 - -
- 1525150..1525215 + 66 NuclAT_26 - -
- 1525150..1525215 + 66 NuclAT_26 - -
- 1525150..1525215 + 66 NuclAT_26 - -
- 1525150..1525215 + 66 NuclAT_27 - -
- 1525150..1525215 + 66 NuclAT_27 - -
- 1525150..1525215 + 66 NuclAT_27 - -
- 1525150..1525215 + 66 NuclAT_27 - -
- 1525150..1525215 + 66 NuclAT_28 - -
- 1525150..1525215 + 66 NuclAT_28 - -
- 1525150..1525215 + 66 NuclAT_28 - -
- 1525150..1525215 + 66 NuclAT_28 - -
- 1525150..1525217 + 68 NuclAT_10 - -
- 1525150..1525217 + 68 NuclAT_10 - -
- 1525150..1525217 + 68 NuclAT_10 - -
- 1525150..1525217 + 68 NuclAT_10 - -
- 1525150..1525217 + 68 NuclAT_12 - -
- 1525150..1525217 + 68 NuclAT_12 - -
- 1525150..1525217 + 68 NuclAT_12 - -
- 1525150..1525217 + 68 NuclAT_12 - -
- 1525150..1525217 + 68 NuclAT_14 - -
- 1525150..1525217 + 68 NuclAT_14 - -
- 1525150..1525217 + 68 NuclAT_14 - -
- 1525150..1525217 + 68 NuclAT_14 - -
- 1525150..1525217 + 68 NuclAT_16 - -
- 1525150..1525217 + 68 NuclAT_16 - -
- 1525150..1525217 + 68 NuclAT_16 - -
- 1525150..1525217 + 68 NuclAT_16 - -
- 1525150..1525217 + 68 NuclAT_18 - -
- 1525150..1525217 + 68 NuclAT_18 - -
- 1525150..1525217 + 68 NuclAT_18 - -
- 1525150..1525217 + 68 NuclAT_18 - -
- 1525150..1525217 + 68 NuclAT_20 - -
- 1525150..1525217 + 68 NuclAT_20 - -
- 1525150..1525217 + 68 NuclAT_20 - -
- 1525150..1525217 + 68 NuclAT_20 - -
GJ11_RS09300 1525507..1526607 - 1101 WP_001306585.1 sodium-potassium/proton antiporter ChaA -
GJ11_RS09305 1526877..1527107 + 231 WP_001146444.1 putative cation transport regulator ChaB -
GJ11_RS09310 1527265..1527960 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
GJ11_RS09315 1528004..1528357 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T62674 WP_000176713.1 NZ_CP015229:c1524567-1524460 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T62674 NZ_CP015229:c1524567-1524460 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT62674 NZ_CP015229:1524619-1524682 [Escherichia coli]
TGGTTCAAGATTAACCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References