Detailed information of TA system TA062506

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 117892..118131
• Replicon: plasmid pEC732_2
• Accession: NZ_CP015140
• Organism: Escherichia coli strain Ecol_732

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: A4X18_RS26785
• Protein ID: WP_023144756.1
• Coordinates: 117997..118131 (+)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	117892..117952 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
A4X18_RS26755	113683..114243	+	561	WP_000139341.1	fertility inhibition protein FinO	-
A4X18_RS26760	114374..114586	+	213	WP_013023861.1	hypothetical protein	-
A4X18_RS26765	115145..115570	+	426	WP_000422741.1	IS66 family insertion sequence hypothetical protein	-
A4X18_RS26770	115567..115917	+	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-
A4X18_RS26775	115948..117561	+	1614	WP_000080195.1	IS66-like element ISEc23 family transposase	-
A4X18_RS26780	117639..117925	+	287	Protein_137	DUF2726 domain-containing protein	-
-	117892..117952	-	61	NuclAT_2	-	Antitoxin
-	117892..117952	-	61	NuclAT_2	-	Antitoxin
-	117892..117952	-	61	NuclAT_2	-	Antitoxin
-	117892..117952	-	61	NuclAT_2	-	Antitoxin
A4X18_RS26785	117997..118131	+	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
A4X18_RS26790	118428..118682	+	255	WP_000083850.1	replication regulatory protein RepA	-
A4X18_RS31580	118788..118922	+	135	Protein_140	protein CopA/IncA	-
A4X18_RS26795	118919..118993	+	75	WP_031943482.1	RepA leader peptide Tap	-
A4X18_RS26800	118986..119843	+	858	WP_001617855.1	incFII family plasmid replication initiator RepA	-
A4X18_RS26805	120783..121436	+	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
A4X18_RS31335	121529..121786	+	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
A4X18_RS26815	121719..122120	+	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
A4X18_RS29460	122369..122784	+	416	Protein_146	IS1 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / blaCTX-M-27 / tet(A)	senB	1..129154	129154

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T62506 WP_023144756.1 NZ_CP015140:117997-118131 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

>T62506 NZ_CP015140:117997-118131 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA

Antitoxin

Nucleotide

• Length: 61 bp

>AT62506 NZ_CP015140:c117952-117892 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin