Detailed information of TA system TA062502

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 94133..94375
• Replicon: plasmid pEC732_2
• Accession: NZ_CP015140
• Organism: Escherichia coli strain Ecol_732

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: A4X18_RS26665
• Protein ID: WP_001312861.1
• Coordinates: 94217..94375 (+)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	94133..94173 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
A4X18_RS26635	89328..91286	+	1959	WP_000117179.1	ParB/RepB/Spo0J family partition protein	-
A4X18_RS26640	91341..91775	+	435	WP_000845940.1	conjugation system SOS inhibitor PsiB	-
A4X18_RS26645	91772..92491	+	720	WP_001276232.1	plasmid SOS inhibition protein A	-
-	92503..92689	+	187	NuclAT_0	-	-
-	92503..92689	+	187	NuclAT_0	-	-
-	92503..92689	+	187	NuclAT_0	-	-
-	92503..92689	+	187	NuclAT_0	-	-
A4X18_RS30285	92737..94106	+	1370	WP_085947770.1	IS3-like element IS150 family transposase	-
-	94133..94173	+	41	NuclAT_1	-	Antitoxin
-	94133..94173	+	41	NuclAT_1	-	Antitoxin
-	94133..94173	+	41	NuclAT_1	-	Antitoxin
-	94133..94173	+	41	NuclAT_1	-	Antitoxin
A4X18_RS26665	94217..94375	+	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
A4X18_RS31570	94818..95153	+	336	WP_013023876.1	hypothetical protein	-
A4X18_RS31575	95066..95272	+	207	WP_000275859.1	hypothetical protein	-
A4X18_RS26675	95297..95584	+	288	WP_000107535.1	hypothetical protein	-
A4X18_RS26680	95703..96218	+	516	Protein_117	DUF945 domain-containing protein	-
A4X18_RS26685	96275..96972	+	698	Protein_118	IS1 family transposase	-
A4X18_RS26690	97020..97340	+	321	WP_001348757.1	conjugal transfer protein TrbA	-
A4X18_RS26695	97467..97751	+	285	WP_001617873.1	type-F conjugative transfer system pilin chaperone TraQ	-
A4X18_RS26700	97738..98283	+	546	WP_000059829.1	type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB	-
A4X18_RS26705	98213..98560	+	348	WP_071571857.1	P-type conjugative transfer protein TrbJ	-
A4X18_RS26710	98508..98933	+	426	WP_001348758.1	F-type conjugal transfer protein TrbF	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / blaCTX-M-27 / tet(A)	senB	1..129154	129154
	-	inside	IScluster/Tn	-	-	92737..96972	4235

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T62502 WP_001312861.1 NZ_CP015140:94217-94375 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

>T62502 NZ_CP015140:94217-94375 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 41 bp

>AT62502 NZ_CP015140:94133-94173 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin