Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 95790..96029 | Replicon | plasmid unnamed |
| Accession | NZ_CP015086 | ||
| Organism | Escherichia coli O25b:H4 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | WLH_RS28410 | Protein ID | WP_023144756.1 |
| Coordinates | 95895..96029 (+) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 95790..95850 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WLH_RS28385 | 93320..94066 | + | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
| WLH_RS28390 | 94121..94681 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| WLH_RS28395 | 94812..95024 | + | 213 | WP_013023861.1 | hypothetical protein | - |
| WLH_RS28405 | 95537..95823 | + | 287 | Protein_105 | DUF2726 domain-containing protein | - |
| - | 95790..95850 | - | 61 | NuclAT_2 | - | Antitoxin |
| - | 95790..95850 | - | 61 | NuclAT_2 | - | Antitoxin |
| - | 95790..95850 | - | 61 | NuclAT_2 | - | Antitoxin |
| - | 95790..95850 | - | 61 | NuclAT_2 | - | Antitoxin |
| WLH_RS28410 | 95895..96029 | + | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| WLH_RS29100 | 96326..96400 | + | 75 | WP_108401337.1 | hypothetical protein | - |
| WLH_RS28415 | 96458..97204 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| WLH_RS28420 | 97219..98508 | - | 1290 | Protein_109 | IS21-like element ISEc12 family transposase | - |
| WLH_RS28425 | 98562..99266 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| WLH_RS28430 | 99332..99844 | + | 513 | Protein_111 | Tn3 family transposase | - |
| WLH_RS28435 | 99868..100473 | - | 606 | WP_000509965.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 | - | 1..130920 | 130920 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T62323 WP_023144756.1 NZ_CP015086:95895-96029 [Escherichia coli O25b:H4]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T62323 NZ_CP015086:95895-96029 [Escherichia coli O25b:H4]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT62323 NZ_CP015086:c95850-95790 [Escherichia coli O25b:H4]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|