Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 67572..67841 | Replicon | plasmid unnamed |
| Accession | NZ_CP015086 | ||
| Organism | Escherichia coli O25b:H4 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | WLH_RS28235 | Protein ID | WP_001312861.1 |
| Coordinates | 67683..67841 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 67572..67637 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WLH_RS28210 | 62793..64751 | + | 1959 | WP_042045562.1 | ParB/RepB/Spo0J family partition protein | - |
| WLH_RS28215 | 64806..65240 | + | 435 | WP_000845949.1 | conjugation system SOS inhibitor PsiB | - |
| WLH_RS28220 | 65237..65956 | + | 720 | WP_033550421.1 | plasmid SOS inhibition protein A | - |
| - | 65968..66070 | + | 103 | NuclAT_1 | - | - |
| - | 65968..66070 | + | 103 | NuclAT_1 | - | - |
| - | 65968..66070 | + | 103 | NuclAT_1 | - | - |
| - | 65968..66070 | + | 103 | NuclAT_1 | - | - |
| WLH_RS28225 | 66116..67485 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - | 67512..67639 | + | 128 | NuclAT_0 | - | - |
| - | 67512..67639 | + | 128 | NuclAT_0 | - | - |
| - | 67512..67639 | + | 128 | NuclAT_0 | - | - |
| - | 67512..67639 | + | 128 | NuclAT_0 | - | - |
| - | 67572..67637 | + | 66 | - | - | Antitoxin |
| WLH_RS28235 | 67683..67841 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| WLH_RS29580 | 68284..68619 | + | 336 | WP_013023876.1 | hypothetical protein | - |
| WLH_RS29585 | 68532..68738 | + | 207 | WP_000275859.1 | hypothetical protein | - |
| WLH_RS28255 | 68763..69050 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| WLH_RS28260 | 69169..69990 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| WLH_RS28265 | 70287..70889 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| WLH_RS28270 | 71219..71602 | + | 384 | WP_001151566.1 | relaxosome protein TraM | - |
| WLH_RS28275 | 71736..72413 | + | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| WLH_RS28280 | 72501..72728 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 | - | 1..130920 | 130920 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T62320 WP_001312861.1 NZ_CP015086:67683-67841 [Escherichia coli O25b:H4]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T62320 NZ_CP015086:67683-67841 [Escherichia coli O25b:H4]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT62320 NZ_CP015086:67572-67637 [Escherichia coli O25b:H4]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|