Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 5284..5613 | Replicon | plasmid pEC448_1 |
Accession | NZ_CP015077 | ||
Organism | Escherichia coli strain Ecol_448 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | A4R37_RS24940 | Protein ID | WP_001312861.1 |
Coordinates | 5284..5442 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 5486..5613 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A4R37_RS24900 | 397..624 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
A4R37_RS24905 | 712..1389 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
A4R37_RS24910 | 1523..1906 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
A4R37_RS24915 | 2237..2839 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
A4R37_RS24920 | 3136..3957 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
A4R37_RS24925 | 4075..4362 | - | 288 | WP_000107535.1 | hypothetical protein | - |
A4R37_RS29800 | 4387..4593 | - | 207 | WP_000275859.1 | hypothetical protein | - |
A4R37_RS29805 | 4506..4841 | - | 336 | WP_013023876.1 | hypothetical protein | - |
A4R37_RS24940 | 5284..5442 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 5486..5613 | - | 128 | NuclAT_0 | - | Antitoxin |
- | 5486..5613 | - | 128 | NuclAT_0 | - | Antitoxin |
- | 5486..5613 | - | 128 | NuclAT_0 | - | Antitoxin |
- | 5486..5613 | - | 128 | NuclAT_0 | - | Antitoxin |
- | 7055..7157 | - | 103 | NuclAT_1 | - | - |
- | 7055..7157 | - | 103 | NuclAT_1 | - | - |
- | 7055..7157 | - | 103 | NuclAT_1 | - | - |
- | 7055..7157 | - | 103 | NuclAT_1 | - | - |
A4R37_RS24960 | 7169..7888 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
A4R37_RS24965 | 7885..8319 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
A4R37_RS24970 | 8374..10332 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id | - | 1..133735 | 133735 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T62264 WP_001312861.1 NZ_CP015077:c5442-5284 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T62264 NZ_CP015077:c5442-5284 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 128 bp
>AT62264 NZ_CP015077:c5613-5486 [Escherichia coli]
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|