Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 41339..41578 | Replicon | plasmid pEC743_1 |
Accession | NZ_CP015070 | ||
Organism | Escherichia coli strain Ecol_743 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A762TWR7 |
Locus tag | A4R39_RS24095 | Protein ID | WP_023144756.1 |
Coordinates | 41339..41473 (-) | Length | 45 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 41518..41578 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A4R39_RS24065 | 36404..37101 | - | 698 | Protein_37 | IS1 family transposase | - |
A4R39_RS24070 | 37350..37751 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
A4R39_RS28700 | 37684..37941 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
A4R39_RS24080 | 38034..38687 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
A4R39_RS24085 | 39627..40484 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
A4R39_RS27340 | 40477..40551 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
A4R39_RS28965 | 40548..40682 | - | 135 | Protein_43 | protein CopA/IncA | - |
A4R39_RS24090 | 40788..41042 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
A4R39_RS24095 | 41339..41473 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 41518..41578 | + | 61 | NuclAT_2 | - | Antitoxin |
- | 41518..41578 | + | 61 | NuclAT_2 | - | Antitoxin |
- | 41518..41578 | + | 61 | NuclAT_2 | - | Antitoxin |
- | 41518..41578 | + | 61 | NuclAT_2 | - | Antitoxin |
A4R39_RS27350 | 41545..41831 | - | 287 | Protein_46 | DUF2726 domain-containing protein | - |
A4R39_RS24100 | 41909..43522 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
A4R39_RS24105 | 43553..43903 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
A4R39_RS24110 | 43900..44325 | - | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
A4R39_RS24115 | 44884..45096 | - | 213 | WP_013023861.1 | hypothetical protein | - |
A4R39_RS24120 | 45227..45787 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | senB | 1..111851 | 111851 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T62196 WP_023144756.1 NZ_CP015070:c41473-41339 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T62196 NZ_CP015070:c41473-41339 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT62196 NZ_CP015070:41518-41578 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|