Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 85544..85765 Replicon chromosome
Accession NZ_CP015069
Organism Escherichia coli strain Ecol_743

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag A4R39_RS00485 Protein ID WP_001531632.1
Coordinates 85544..85651 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 85699..85765 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A4R39_RS00460 81388..82470 + 1083 WP_000804726.1 peptide chain release factor 1 -
A4R39_RS00465 82470..83303 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
A4R39_RS00470 83300..83692 + 393 WP_000200375.1 invasion regulator SirB2 -
A4R39_RS00475 83696..84505 + 810 WP_001257044.1 invasion regulator SirB1 -
A4R39_RS00480 84541..85395 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
A4R39_RS00485 85544..85651 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 85699..85765 + 67 NuclAT_10 - Antitoxin
- 85699..85765 + 67 NuclAT_10 - Antitoxin
- 85699..85765 + 67 NuclAT_10 - Antitoxin
- 85699..85765 + 67 NuclAT_10 - Antitoxin
- 85699..85765 + 67 NuclAT_11 - Antitoxin
- 85699..85765 + 67 NuclAT_11 - Antitoxin
- 85699..85765 + 67 NuclAT_11 - Antitoxin
- 85699..85765 + 67 NuclAT_11 - Antitoxin
- 85699..85765 + 67 NuclAT_12 - Antitoxin
- 85699..85765 + 67 NuclAT_12 - Antitoxin
- 85699..85765 + 67 NuclAT_12 - Antitoxin
- 85699..85765 + 67 NuclAT_12 - Antitoxin
- 85699..85765 + 67 NuclAT_13 - Antitoxin
- 85699..85765 + 67 NuclAT_13 - Antitoxin
- 85699..85765 + 67 NuclAT_13 - Antitoxin
- 85699..85765 + 67 NuclAT_13 - Antitoxin
- 85699..85765 + 67 NuclAT_8 - Antitoxin
- 85699..85765 + 67 NuclAT_8 - Antitoxin
- 85699..85765 + 67 NuclAT_8 - Antitoxin
- 85699..85765 + 67 NuclAT_8 - Antitoxin
- 85699..85765 + 67 NuclAT_9 - Antitoxin
- 85699..85765 + 67 NuclAT_9 - Antitoxin
- 85699..85765 + 67 NuclAT_9 - Antitoxin
- 85699..85765 + 67 NuclAT_9 - Antitoxin
- 85701..85764 + 64 NuclAT_15 - -
- 85701..85764 + 64 NuclAT_15 - -
- 85701..85764 + 64 NuclAT_15 - -
- 85701..85764 + 64 NuclAT_15 - -
- 85701..85764 + 64 NuclAT_16 - -
- 85701..85764 + 64 NuclAT_16 - -
- 85701..85764 + 64 NuclAT_16 - -
- 85701..85764 + 64 NuclAT_16 - -
- 85701..85764 + 64 NuclAT_17 - -
- 85701..85764 + 64 NuclAT_17 - -
- 85701..85764 + 64 NuclAT_17 - -
- 85701..85764 + 64 NuclAT_17 - -
- 85701..85764 + 64 NuclAT_18 - -
- 85701..85764 + 64 NuclAT_18 - -
- 85701..85764 + 64 NuclAT_18 - -
- 85701..85764 + 64 NuclAT_18 - -
- 85701..85764 + 64 NuclAT_19 - -
- 85701..85764 + 64 NuclAT_19 - -
- 85701..85764 + 64 NuclAT_19 - -
- 85701..85764 + 64 NuclAT_19 - -
- 85701..85764 + 64 NuclAT_20 - -
- 85701..85764 + 64 NuclAT_20 - -
- 85701..85764 + 64 NuclAT_20 - -
- 85701..85764 + 64 NuclAT_20 - -
- 85701..85766 + 66 NuclAT_21 - -
- 85701..85766 + 66 NuclAT_21 - -
- 85701..85766 + 66 NuclAT_21 - -
- 85701..85766 + 66 NuclAT_21 - -
- 85701..85766 + 66 NuclAT_22 - -
- 85701..85766 + 66 NuclAT_22 - -
- 85701..85766 + 66 NuclAT_22 - -
- 85701..85766 + 66 NuclAT_22 - -
- 85701..85766 + 66 NuclAT_23 - -
- 85701..85766 + 66 NuclAT_23 - -
- 85701..85766 + 66 NuclAT_23 - -
- 85701..85766 + 66 NuclAT_23 - -
- 85701..85766 + 66 NuclAT_24 - -
- 85701..85766 + 66 NuclAT_24 - -
- 85701..85766 + 66 NuclAT_24 - -
- 85701..85766 + 66 NuclAT_24 - -
- 85701..85766 + 66 NuclAT_25 - -
- 85701..85766 + 66 NuclAT_25 - -
- 85701..85766 + 66 NuclAT_25 - -
- 85701..85766 + 66 NuclAT_25 - -
- 85701..85766 + 66 NuclAT_26 - -
- 85701..85766 + 66 NuclAT_26 - -
- 85701..85766 + 66 NuclAT_26 - -
- 85701..85766 + 66 NuclAT_26 - -
A4R39_RS00490 86056..87156 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
A4R39_RS00495 87426..87665 + 240 WP_000120702.1 putative cation transport regulator ChaB -
A4R39_RS00500 87814..88509 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
A4R39_RS00505 88553..88906 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
A4R39_RS00510 89091..90485 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T62162 WP_001531632.1 NZ_CP015069:c85651-85544 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T62162 NZ_CP015069:c85651-85544 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT62162 NZ_CP015069:85699-85765 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References