Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
Location | 2526724..2526945 | Replicon | chromosome |
Accession | NZ_CP015023 | ||
Organism | Escherichia coli strain SRCC 1675 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | AR439_RS31805 | Protein ID | WP_001295224.1 |
Coordinates | 2526724..2526831 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 2526880..2526945 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AR439_RS13615 | 2521977..2522729 | - | 753 | Protein_2500 | cellulose biosynthesis protein BcsQ | - |
AR439_RS13625 | 2522741..2522929 | - | 189 | WP_001063316.1 | YhjR family protein | - |
AR439_RS13630 | 2523202..2524773 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
AR439_RS13635 | 2524770..2524961 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
AR439_RS13640 | 2524958..2526637 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
AR439_RS31805 | 2526724..2526831 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 2526880..2526945 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 2526880..2526945 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 2526880..2526945 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 2526880..2526945 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 2526880..2526945 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 2526880..2526945 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 2526880..2526945 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 2526880..2526945 | + | 66 | NuclAT_22 | - | Antitoxin |
AR439_RS13655 | 2527307..2528578 | + | 1272 | WP_001301684.1 | amino acid permease | - |
AR439_RS13660 | 2528608..2529612 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
AR439_RS13665 | 2529609..2530592 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
AR439_RS13670 | 2530603..2531505 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T62094 WP_001295224.1 NZ_CP015023:c2526831-2526724 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T62094 NZ_CP015023:c2526831-2526724 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT62094 NZ_CP015023:2526880-2526945 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|