Detailed information of TA system TA062070

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 5435310..5435524
• Replicon: chromosome
• Accession: NZ_CP015020
• Organism: Escherichia coli strain 28RC1

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: ARC77_RS27685
• Protein ID: WP_000170963.1
• Coordinates: 5435310..5435417 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	5435465..5435524 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ARC77_RS27655	5430619..5431701	+	1083	WP_000804726.1	peptide chain release factor 1	-
ARC77_RS27660	5431701..5432534	+	834	WP_000456466.1	peptide chain release factor N(5)-glutamine methyltransferase	-
ARC77_RS27665	5432531..5432923	+	393	WP_000200379.1	invasion regulator SirB2	-
ARC77_RS27670	5432927..5433736	+	810	WP_001257044.1	invasion regulator SirB1	-
ARC77_RS27675	5433772..5434626	+	855	WP_000811067.1	3-deoxy-8-phosphooctulonate synthase	-
ARC77_RS27680	5434774..5434881	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	5434934..5434995	+	62	NuclAT_24	-	-
-	5434934..5434995	+	62	NuclAT_24	-	-
-	5434934..5434995	+	62	NuclAT_24	-	-
-	5434934..5434995	+	62	NuclAT_24	-	-
-	5434934..5434995	+	62	NuclAT_26	-	-
-	5434934..5434995	+	62	NuclAT_26	-	-
-	5434934..5434995	+	62	NuclAT_26	-	-
-	5434934..5434995	+	62	NuclAT_26	-	-
-	5434934..5434995	+	62	NuclAT_28	-	-
-	5434934..5434995	+	62	NuclAT_28	-	-
-	5434934..5434995	+	62	NuclAT_28	-	-
-	5434934..5434995	+	62	NuclAT_28	-	-
-	5434934..5434995	+	62	NuclAT_30	-	-
-	5434934..5434995	+	62	NuclAT_30	-	-
-	5434934..5434995	+	62	NuclAT_30	-	-
-	5434934..5434995	+	62	NuclAT_30	-	-
-	5434934..5434995	+	62	NuclAT_32	-	-
-	5434934..5434995	+	62	NuclAT_32	-	-
-	5434934..5434995	+	62	NuclAT_32	-	-
-	5434934..5434995	+	62	NuclAT_32	-	-
-	5434934..5434996	+	63	NuclAT_17	-	-
-	5434934..5434996	+	63	NuclAT_17	-	-
-	5434934..5434996	+	63	NuclAT_17	-	-
-	5434934..5434996	+	63	NuclAT_17	-	-
-	5434934..5434996	+	63	NuclAT_18	-	-
-	5434934..5434996	+	63	NuclAT_18	-	-
-	5434934..5434996	+	63	NuclAT_18	-	-
-	5434934..5434996	+	63	NuclAT_18	-	-
-	5434934..5434996	+	63	NuclAT_19	-	-
-	5434934..5434996	+	63	NuclAT_19	-	-
-	5434934..5434996	+	63	NuclAT_19	-	-
-	5434934..5434996	+	63	NuclAT_19	-	-
-	5434934..5434996	+	63	NuclAT_20	-	-
-	5434934..5434996	+	63	NuclAT_20	-	-
-	5434934..5434996	+	63	NuclAT_20	-	-
-	5434934..5434996	+	63	NuclAT_20	-	-
-	5434934..5434996	+	63	NuclAT_22	-	-
-	5434934..5434996	+	63	NuclAT_22	-	-
-	5434934..5434996	+	63	NuclAT_22	-	-
-	5434934..5434996	+	63	NuclAT_22	-	-
-	5434934..5434996	+	63	NuclAT_23	-	-
-	5434934..5434996	+	63	NuclAT_23	-	-
-	5434934..5434996	+	63	NuclAT_23	-	-
-	5434934..5434996	+	63	NuclAT_23	-	-
ARC77_RS27685	5435310..5435417	-	108	WP_000170963.1	small toxic polypeptide LdrB	Toxin
-	5435465..5435524	+	60	NuclAT_25	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_25	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_25	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_25	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_27	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_27	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_27	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_27	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_29	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_29	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_29	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_29	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_31	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_31	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_31	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_31	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_33	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_33	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_33	-	Antitoxin
-	5435465..5435524	+	60	NuclAT_33	-	Antitoxin
ARC77_RS27690	5435816..5436916	-	1101	WP_001301956.1	sodium-potassium/proton antiporter ChaA	-
ARC77_RS27695	5437186..5437416	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
ARC77_RS27700	5437577..5438272	+	696	WP_001301489.1	glutathione-specific gamma-glutamylcyclotransferase	-
ARC77_RS27705	5438316..5438669	-	354	WP_001169661.1	DsrE/F sulfur relay family protein YchN	-
ARC77_RS27710	5438855..5440249	+	1395	WP_000086192.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T62070 WP_000170963.1 NZ_CP015020:c5435417-5435310 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T62070 NZ_CP015020:c5435417-5435310 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT62070 NZ_CP015020:5435465-5435524 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin