Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4942238..4942463 | Replicon | chromosome |
| Accession | NZ_CP015020 | ||
| Organism | Escherichia coli strain 28RC1 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | ARC77_RS24940 | Protein ID | WP_000813263.1 |
| Coordinates | 4942308..4942463 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 4942238..4942296 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ARC77_RS24915 | 4937519..4938604 | + | 1086 | WP_072141648.1 | DNA-binding protein | - |
| ARC77_RS24920 | 4938611..4939357 | + | 747 | WP_000788745.1 | ATP-binding protein | - |
| ARC77_RS24925 | 4939379..4940149 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| ARC77_RS24930 | 4940165..4940578 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
| ARC77_RS24935 | 4940930..4941703 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| - | 4942238..4942296 | - | 59 | - | - | Antitoxin |
| ARC77_RS24940 | 4942308..4942463 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| ARC77_RS32080 | 4942631..4942909 | + | 279 | WP_001341388.1 | hypothetical protein | - |
| ARC77_RS24950 | 4942911..4943960 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| ARC77_RS24955 | 4943973..4944344 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ARC77_RS24960 | 4944334..4944705 | + | 372 | WP_000090264.1 | antitermination protein | - |
| ARC77_RS24965 | 4944857..4945675 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| ARC77_RS24970 | 4945962..4946158 | + | 197 | Protein_4711 | TrmB family transcriptional regulator | - |
| ARC77_RS24975 | 4946296..4947009 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T62066 WP_000813263.1 NZ_CP015020:4942308-4942463 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T62066 NZ_CP015020:4942308-4942463 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT62066 NZ_CP015020:c4942296-4942238 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|