Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 737015..737240 | Replicon | chromosome |
| Accession | NZ_CP015020 | ||
| Organism | Escherichia coli strain 28RC1 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | ARC77_RS03880 | Protein ID | WP_000813254.1 |
| Coordinates | 737015..737170 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 737182..737240 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ARC77_RS03850 | 732301..733359 | - | 1059 | WP_000935552.1 | site-specific DNA-methyltransferase | - |
| ARC77_RS03855 | 733510..733707 | - | 198 | WP_000917735.1 | hypothetical protein | - |
| ARC77_RS03860 | 733934..734755 | - | 822 | WP_000762909.1 | antitermination protein | - |
| ARC77_RS03865 | 734752..735126 | - | 375 | WP_000904137.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ARC77_RS03870 | 735139..736188 | - | 1050 | WP_001265167.1 | DUF968 domain-containing protein | - |
| ARC77_RS31495 | 736190..736468 | - | 279 | WP_032156506.1 | hypothetical protein | - |
| ARC77_RS03875 | 736538..736798 | - | 261 | WP_077625879.1 | hypothetical protein | - |
| ARC77_RS03880 | 737015..737170 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 737182..737240 | + | 59 | - | - | Antitoxin |
| ARC77_RS03885 | 737581..738375 | + | 795 | WP_000373318.1 | protein kinase | - |
| ARC77_RS03890 | 738359..739075 | + | 717 | WP_000789359.1 | protein phosphatase 2C domain-containing protein | - |
| ARC77_RS33310 | 739335..739508 | - | 174 | WP_001224661.1 | hypothetical protein | - |
| ARC77_RS03895 | 739603..739959 | - | 357 | WP_000403785.1 | hypothetical protein | - |
| ARC77_RS03900 | 740032..740412 | - | 381 | WP_001118156.1 | DUF977 family protein | - |
| ARC77_RS03905 | 740428..741198 | - | 771 | WP_000450846.1 | DUF1627 domain-containing protein | - |
| ARC77_RS32470 | 741232..741774 | - | 543 | WP_157837342.1 | replication protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleC / stx2B / stx2A | 704979..794733 | 89754 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T62042 WP_000813254.1 NZ_CP015020:c737170-737015 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T62042 NZ_CP015020:c737170-737015 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT62042 NZ_CP015020:737182-737240 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|