Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 377083..377308 | Replicon | chromosome |
| Accession | NZ_CP015020 | ||
| Organism | Escherichia coli strain 28RC1 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | ARC77_RS02090 | Protein ID | WP_000813258.1 |
| Coordinates | 377153..377308 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 377083..377141 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ARC77_RS02040 | 372136..372378 | + | 243 | WP_000747948.1 | hypothetical protein | - |
| ARC77_RS02045 | 372362..372787 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
| ARC77_RS32385 | 372856..373911 | + | 1056 | WP_001356791.1 | hypothetical protein | - |
| ARC77_RS32390 | 373904..374365 | + | 462 | WP_000139447.1 | replication protein | - |
| ARC77_RS02060 | 374399..375115 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| ARC77_RS02065 | 375148..375429 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
| ARC77_RS02070 | 375426..375653 | + | 228 | WP_000699809.1 | hypothetical protein | - |
| ARC77_RS02075 | 375646..375957 | + | 312 | WP_001289673.1 | hypothetical protein | - |
| ARC77_RS02080 | 376085..376303 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
| ARC77_RS02085 | 376305..376862 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| - | 377083..377141 | - | 59 | - | - | Antitoxin |
| ARC77_RS02090 | 377153..377308 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| ARC77_RS02095 | 377428..377772 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| ARC77_RS02100 | 377894..378166 | + | 273 | WP_000191871.1 | hypothetical protein | - |
| ARC77_RS02105 | 378168..379217 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| ARC77_RS02110 | 379230..379535 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ARC77_RS02115 | 379598..380152 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
| ARC77_RS32395 | 380377..380574 | + | 198 | WP_000917763.1 | hypothetical protein | - |
| ARC77_RS02125 | 380710..381423 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| ARC77_RS02140 | 381874..382305 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 316408..416304 | 99896 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T62039 WP_000813258.1 NZ_CP015020:377153-377308 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T62039 NZ_CP015020:377153-377308 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT62039 NZ_CP015020:c377141-377083 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|