Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3995481..3995703 | Replicon | chromosome |
| Accession | NZ_CP014667 | ||
| Organism | Escherichia coli strain ECONIH2 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | WM48_RS28765 | Protein ID | WP_001295224.1 |
| Coordinates | 3995481..3995588 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3995637..3995703 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WM48_RS19555 | 3990734..3991486 | - | 753 | WP_000279536.1 | cellulose biosynthesis protein BcsQ | - |
| WM48_RS19560 | 3991498..3991686 | - | 189 | WP_001063314.1 | YhjR family protein | - |
| WM48_RS19565 | 3991959..3993530 | + | 1572 | WP_001204945.1 | cellulose biosynthesis protein BcsE | - |
| WM48_RS19570 | 3993527..3993718 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| WM48_RS19575 | 3993715..3995394 | + | 1680 | Protein_3747 | cellulose biosynthesis protein BcsG | - |
| WM48_RS28765 | 3995481..3995588 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 3995637..3995703 | + | 67 | - | - | Antitoxin |
| WM48_RS19590 | 3996064..3997335 | + | 1272 | WP_001298005.1 | amino acid permease | - |
| WM48_RS19595 | 3997365..3998369 | - | 1005 | WP_000103577.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| WM48_RS19600 | 3998366..3999349 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
| WM48_RS19605 | 3999360..4000262 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T61667 WP_001295224.1 NZ_CP014667:c3995588-3995481 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T61667 NZ_CP014667:c3995588-3995481 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT61667 NZ_CP014667:3995637-3995703 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|