Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 42694..42936 | Replicon | plasmid pZH193 |
Accession | NZ_CP014498 | ||
Organism | Escherichia coli strain ZH193 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | AVR69_RS25495 | Protein ID | WP_001312861.1 |
Coordinates | 42694..42852 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 42896..42936 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AVR69_RS25455 | 37806..38033 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
AVR69_RS25460 | 38121..38798 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
AVR69_RS25465 | 38932..39315 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
AVR69_RS25470 | 39646..40248 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
AVR69_RS25475 | 40545..41366 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
AVR69_RS25480 | 41485..41772 | - | 288 | WP_000107535.1 | hypothetical protein | - |
AVR69_RS30305 | 41797..42003 | - | 207 | WP_000275859.1 | hypothetical protein | - |
AVR69_RS25495 | 42694..42852 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 42896..42936 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 42896..42936 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 42896..42936 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 42896..42936 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 44380..44566 | - | 187 | NuclAT_0 | - | - |
- | 44380..44566 | - | 187 | NuclAT_0 | - | - |
- | 44380..44566 | - | 187 | NuclAT_0 | - | - |
- | 44380..44566 | - | 187 | NuclAT_0 | - | - |
AVR69_RS25515 | 44578..45297 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
AVR69_RS25520 | 45294..45728 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
AVR69_RS25525 | 45783..47741 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / dfrA17 / aac(3)-IId / blaTEM-1B | senB | 1..209768 | 209768 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T61355 WP_001312861.1 NZ_CP014498:c42852-42694 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T61355 NZ_CP014498:c42852-42694 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 41 bp
>AT61355 NZ_CP014498:c42936-42896 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|