Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 858..1097 | Replicon | plasmid pZH193 |
| Accession | NZ_CP014498 | ||
| Organism | Escherichia coli strain ZH193 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | AVR69_RS25255 | Protein ID | WP_023144756.1 |
| Coordinates | 858..992 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 1037..1097 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AVR69_RS30300 | 67..201 | - | 135 | Protein_2 | protein CopA/IncA | - |
| AVR69_RS25250 | 307..561 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| AVR69_RS25255 | 858..992 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 1037..1097 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 1037..1097 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 1037..1097 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 1037..1097 | + | 61 | NuclAT_2 | - | Antitoxin |
| AVR69_RS25260 | 1064..1350 | - | 287 | Protein_5 | DUF2726 domain-containing protein | - |
| AVR69_RS25265 | 1428..3041 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| AVR69_RS25270 | 3072..3422 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| AVR69_RS25275 | 3419..3844 | - | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
| AVR69_RS25280 | 4403..4615 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| AVR69_RS25285 | 4746..5306 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / dfrA17 / aac(3)-IId / blaTEM-1B | senB | 1..209768 | 209768 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T61351 WP_023144756.1 NZ_CP014498:c992-858 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T61351 NZ_CP014498:c992-858 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT61351 NZ_CP014498:1037-1097 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|