Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2308050..2308267 | Replicon | chromosome |
Accession | NZ_CP014432 | ||
Organism | Staphylococcus aureus strain USA300-SUR20 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | AYM33_RS12255 | Protein ID | WP_001802298.1 |
Coordinates | 2308163..2308267 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2308050..2308105 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AYM33_RS12235 | 2304187..2304852 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
AYM33_RS12240 | 2305004..2305324 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
AYM33_RS12245 | 2305326..2306306 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
AYM33_RS12250 | 2306572..2307663 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2308050..2308105 | + | 56 | - | - | Antitoxin |
AYM33_RS12255 | 2308163..2308267 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
AYM33_RS15760 | 2308428..2308911 | - | 484 | Protein_2264 | recombinase family protein | - |
AYM33_RS12265 | 2308954..2310090 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
AYM33_RS12270 | 2310379..2310471 | + | 93 | WP_001790138.1 | hypothetical protein | - |
AYM33_RS12275 | 2311176..2312033 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
AYM33_RS12280 | 2312101..2312883 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T61154 WP_001802298.1 NZ_CP014432:c2308267-2308163 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T61154 NZ_CP014432:c2308267-2308163 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT61154 NZ_CP014432:2308050-2308105 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|