Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2137660..2137959 | Replicon | chromosome |
Accession | NZ_CP014412 | ||
Organism | Staphylococcus aureus strain USA300-SUR14 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | AYM27_RS11250 | Protein ID | WP_011447039.1 |
Coordinates | 2137783..2137959 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2137660..2137715 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AYM27_RS11195 | 2132991..2133251 | + | 261 | WP_001791826.1 | hypothetical protein | - |
AYM27_RS11200 | 2133304..2133654 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
AYM27_RS11205 | 2134339..2134788 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
AYM27_RS15785 | 2134883..2135218 | - | 336 | Protein_2072 | SH3 domain-containing protein | - |
AYM27_RS11230 | 2135868..2136359 | - | 492 | WP_000919350.1 | staphylokinase | - |
AYM27_RS11235 | 2136550..2137305 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
AYM27_RS11240 | 2137317..2137571 | - | 255 | WP_000611512.1 | phage holin | - |
AYM27_RS11245 | 2137623..2137730 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2137652..2137791 | + | 140 | NuclAT_0 | - | - |
- | 2137652..2137791 | + | 140 | NuclAT_0 | - | - |
- | 2137652..2137791 | + | 140 | NuclAT_0 | - | - |
- | 2137652..2137791 | + | 140 | NuclAT_0 | - | - |
- | 2137660..2137715 | + | 56 | - | - | Antitoxin |
AYM27_RS11250 | 2137783..2137959 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
AYM27_RS11255 | 2138109..2138405 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
AYM27_RS11260 | 2138463..2138750 | - | 288 | WP_001040261.1 | hypothetical protein | - |
AYM27_RS11265 | 2138797..2138949 | - | 153 | WP_001153681.1 | hypothetical protein | - |
AYM27_RS11270 | 2138939..2142724 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb | 2133304..2178303 | 44999 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T61037 WP_011447039.1 NZ_CP014412:c2137959-2137783 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T61037 NZ_CP014412:c2137959-2137783 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT61037 NZ_CP014412:2137660-2137715 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|