Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1976740..1976922 | Replicon | chromosome |
Accession | NZ_CP014412 | ||
Organism | Staphylococcus aureus strain USA300-SUR14 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | AYM27_RS15765 | Protein ID | WP_001801861.1 |
Coordinates | 1976740..1976835 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1976863..1976922 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AYM27_RS10165 | 1972400..1973026 | + | 627 | Protein_1910 | hypothetical protein | - |
AYM27_RS10170 | 1973067..1973411 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
AYM27_RS10175 | 1973509..1974060 | + | 552 | WP_000414205.1 | hypothetical protein | - |
AYM27_RS10180 | 1974278..1974919 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
AYM27_RS10185 | 1975033..1975218 | - | 186 | WP_000809857.1 | hypothetical protein | - |
AYM27_RS10190 | 1975220..1975396 | - | 177 | WP_000375476.1 | hypothetical protein | - |
AYM27_RS10195 | 1975407..1975790 | - | 384 | WP_000070811.1 | hypothetical protein | - |
AYM27_RS10205 | 1976394..1976537 | - | 144 | WP_001549059.1 | transposase | - |
AYM27_RS15765 | 1976740..1976835 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1976863..1976922 | - | 60 | - | - | Antitoxin |
AYM27_RS10210 | 1976958..1977059 | + | 102 | WP_001791893.1 | hypothetical protein | - |
AYM27_RS10215 | 1977037..1977213 | - | 177 | Protein_1920 | transposase | - |
AYM27_RS10220 | 1977407..1977784 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1946375..2010011 | 63636 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T61034 WP_001801861.1 NZ_CP014412:1976740-1976835 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T61034 NZ_CP014412:1976740-1976835 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT61034 NZ_CP014412:c1976922-1976863 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|