Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2137490..2137789 | Replicon | chromosome |
Accession | NZ_CP014409 | ||
Organism | Staphylococcus aureus strain USA300-SUR13 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | AYM26_RS11230 | Protein ID | WP_011447039.1 |
Coordinates | 2137613..2137789 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2137490..2137545 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AYM26_RS11175 | 2132821..2133081 | + | 261 | WP_001791826.1 | hypothetical protein | - |
AYM26_RS11180 | 2133134..2133484 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
AYM26_RS11185 | 2134169..2134618 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
AYM26_RS15785 | 2134713..2135048 | - | 336 | Protein_2073 | SH3 domain-containing protein | - |
AYM26_RS11210 | 2135698..2136189 | - | 492 | WP_000919350.1 | staphylokinase | - |
AYM26_RS11215 | 2136380..2137135 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
AYM26_RS11220 | 2137147..2137401 | - | 255 | WP_000611512.1 | phage holin | - |
AYM26_RS11225 | 2137453..2137560 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2137482..2137621 | + | 140 | NuclAT_0 | - | - |
- | 2137482..2137621 | + | 140 | NuclAT_0 | - | - |
- | 2137482..2137621 | + | 140 | NuclAT_0 | - | - |
- | 2137482..2137621 | + | 140 | NuclAT_0 | - | - |
- | 2137490..2137545 | + | 56 | - | - | Antitoxin |
AYM26_RS11230 | 2137613..2137789 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
AYM26_RS11235 | 2137939..2138235 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
AYM26_RS11240 | 2138293..2138580 | - | 288 | WP_001040261.1 | hypothetical protein | - |
AYM26_RS11245 | 2138627..2138779 | - | 153 | WP_001153681.1 | hypothetical protein | - |
AYM26_RS11250 | 2138769..2142554 | - | 3786 | WP_077467069.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb | 2133134..2178133 | 44999 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T61019 WP_011447039.1 NZ_CP014409:c2137789-2137613 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T61019 NZ_CP014409:c2137789-2137613 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT61019 NZ_CP014409:2137490-2137545 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|