Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1976502..1976684 | Replicon | chromosome |
Accession | NZ_CP014409 | ||
Organism | Staphylococcus aureus strain USA300-SUR13 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | AYM26_RS15760 | Protein ID | WP_001801861.1 |
Coordinates | 1976502..1976597 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1976625..1976684 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AYM26_RS10145 | 1972162..1972788 | + | 627 | Protein_1911 | hypothetical protein | - |
AYM26_RS10150 | 1972829..1973173 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
AYM26_RS10155 | 1973271..1973822 | + | 552 | WP_000414205.1 | hypothetical protein | - |
AYM26_RS10160 | 1974040..1974681 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
AYM26_RS10165 | 1974795..1974980 | - | 186 | WP_000809857.1 | hypothetical protein | - |
AYM26_RS10170 | 1974982..1975158 | - | 177 | WP_000375476.1 | hypothetical protein | - |
AYM26_RS10175 | 1975169..1975552 | - | 384 | WP_000070811.1 | hypothetical protein | - |
AYM26_RS10185 | 1976156..1976299 | - | 144 | WP_001549059.1 | transposase | - |
AYM26_RS15760 | 1976502..1976597 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1976625..1976684 | - | 60 | - | - | Antitoxin |
AYM26_RS10190 | 1976720..1976821 | + | 102 | WP_001791893.1 | hypothetical protein | - |
AYM26_RS10195 | 1976799..1976975 | - | 177 | Protein_1921 | transposase | - |
AYM26_RS10200 | 1977169..1977546 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1946137..2009773 | 63636 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T61016 WP_001801861.1 NZ_CP014409:1976502-1976597 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T61016 NZ_CP014409:1976502-1976597 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT61016 NZ_CP014409:c1976684-1976625 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|