Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2135767..2136066 | Replicon | chromosome |
Accession | NZ_CP014387 | ||
Organism | Staphylococcus aureus strain USA300-SUR8 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | AYM21_RS11235 | Protein ID | WP_011447039.1 |
Coordinates | 2135890..2136066 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2135767..2135822 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AYM21_RS11190 | 2131098..2131358 | + | 261 | WP_001791826.1 | hypothetical protein | - |
AYM21_RS11195 | 2131411..2131761 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
AYM21_RS11200 | 2132446..2132895 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
AYM21_RS11205 | 2132990..2133325 | - | 336 | Protein_2071 | SH3 domain-containing protein | - |
AYM21_RS11215 | 2133975..2134466 | - | 492 | WP_000919350.1 | staphylokinase | - |
AYM21_RS11220 | 2134657..2135412 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
AYM21_RS11225 | 2135424..2135678 | - | 255 | WP_000611512.1 | phage holin | - |
AYM21_RS11230 | 2135730..2135837 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2135759..2135898 | + | 140 | NuclAT_0 | - | - |
- | 2135759..2135898 | + | 140 | NuclAT_0 | - | - |
- | 2135759..2135898 | + | 140 | NuclAT_0 | - | - |
- | 2135759..2135898 | + | 140 | NuclAT_0 | - | - |
- | 2135767..2135822 | + | 56 | - | - | Antitoxin |
AYM21_RS11235 | 2135890..2136066 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
AYM21_RS11240 | 2136216..2136512 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
AYM21_RS11245 | 2136570..2136857 | - | 288 | WP_001040261.1 | hypothetical protein | - |
AYM21_RS11250 | 2136904..2137056 | - | 153 | WP_001153681.1 | hypothetical protein | - |
AYM21_RS11255 | 2137046..2140831 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2131411..2187359 | 55948 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T60931 WP_011447039.1 NZ_CP014387:c2136066-2135890 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T60931 NZ_CP014387:c2136066-2135890 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT60931 NZ_CP014387:2135767-2135822 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|