Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2312278..2312495 | Replicon | chromosome |
| Accession | NZ_CP014384 | ||
| Organism | Staphylococcus aureus strain USA300-SUR7 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | AYM20_RS12265 | Protein ID | WP_001802298.1 |
| Coordinates | 2312391..2312495 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 2312278..2312333 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYM20_RS12245 | 2308415..2309080 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| AYM20_RS12250 | 2309232..2309552 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| AYM20_RS12255 | 2309554..2310534 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| AYM20_RS12260 | 2310800..2311891 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| - | 2312278..2312333 | + | 56 | - | - | Antitoxin |
| AYM20_RS12265 | 2312391..2312495 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| AYM20_RS15650 | 2312656..2313139 | - | 484 | Protein_2272 | recombinase family protein | - |
| AYM20_RS12275 | 2313182..2314318 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| AYM20_RS12280 | 2314607..2314699 | + | 93 | WP_001790138.1 | hypothetical protein | - |
| AYM20_RS12285 | 2315404..2316261 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
| AYM20_RS12290 | 2316329..2317111 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T60922 WP_001802298.1 NZ_CP014384:c2312495-2312391 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T60922 NZ_CP014384:c2312495-2312391 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT60922 NZ_CP014384:2312278-2312333 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|