Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1976581..1976763 | Replicon | chromosome |
Accession | NZ_CP014371 | ||
Organism | Staphylococcus aureus strain USA300-SUR4 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | AYM16_RS10180 | Protein ID | WP_001801861.1 |
Coordinates | 1976581..1976676 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1976704..1976763 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AYM16_RS10130 | 1972241..1972867 | + | 627 | Protein_1912 | hypothetical protein | - |
AYM16_RS10135 | 1972908..1973252 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
AYM16_RS10140 | 1973350..1973901 | + | 552 | WP_000414205.1 | hypothetical protein | - |
AYM16_RS10145 | 1974119..1974760 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
AYM16_RS10150 | 1974874..1975059 | - | 186 | WP_000809857.1 | hypothetical protein | - |
AYM16_RS10155 | 1975061..1975237 | - | 177 | WP_000375476.1 | hypothetical protein | - |
AYM16_RS10160 | 1975248..1975631 | - | 384 | WP_000070811.1 | hypothetical protein | - |
AYM16_RS10170 | 1976235..1976378 | - | 144 | WP_001549059.1 | transposase | - |
AYM16_RS10180 | 1976581..1976676 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1976704..1976763 | - | 60 | - | - | Antitoxin |
AYM16_RS10185 | 1976799..1976900 | + | 102 | WP_001791893.1 | hypothetical protein | - |
AYM16_RS10190 | 1976878..1977054 | - | 177 | Protein_1922 | transposase | - |
AYM16_RS10195 | 1977248..1977625 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1950555..2008108 | 57553 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T60856 WP_001801861.1 NZ_CP014371:1976581-1976676 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T60856 NZ_CP014371:1976581-1976676 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT60856 NZ_CP014371:c1976763-1976704 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|