Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2122727..2123026 | Replicon | chromosome |
Accession | NZ_CP014365 | ||
Organism | Staphylococcus aureus strain USA300-SUR2 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | AYM14_RS11175 | Protein ID | WP_011447039.1 |
Coordinates | 2122850..2123026 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2122727..2122782 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AYM14_RS11130 | 2118058..2118318 | + | 261 | WP_001791826.1 | hypothetical protein | - |
AYM14_RS11135 | 2118371..2118721 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
AYM14_RS11140 | 2119406..2119855 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
AYM14_RS11145 | 2119950..2120285 | - | 336 | Protein_2060 | SH3 domain-containing protein | - |
AYM14_RS11155 | 2120935..2121426 | - | 492 | WP_000919350.1 | staphylokinase | - |
AYM14_RS11160 | 2121617..2122372 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
AYM14_RS11165 | 2122384..2122638 | - | 255 | WP_000611512.1 | phage holin | - |
AYM14_RS11170 | 2122690..2122797 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2122719..2122858 | + | 140 | NuclAT_0 | - | - |
- | 2122719..2122858 | + | 140 | NuclAT_0 | - | - |
- | 2122719..2122858 | + | 140 | NuclAT_0 | - | - |
- | 2122719..2122858 | + | 140 | NuclAT_0 | - | - |
- | 2122727..2122782 | + | 56 | - | - | Antitoxin |
AYM14_RS11175 | 2122850..2123026 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
AYM14_RS11180 | 2123176..2123472 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
AYM14_RS11185 | 2123530..2123817 | - | 288 | WP_001040261.1 | hypothetical protein | - |
AYM14_RS11190 | 2123864..2124016 | - | 153 | WP_001153681.1 | hypothetical protein | - |
AYM14_RS11195 | 2124006..2127791 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2118371..2174318 | 55947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T60825 WP_011447039.1 NZ_CP014365:c2123026-2122850 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T60825 NZ_CP014365:c2123026-2122850 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT60825 NZ_CP014365:2122727-2122782 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|