Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1961737..1961919 | Replicon | chromosome |
Accession | NZ_CP014362 | ||
Organism | Staphylococcus aureus strain USA300-SUR1 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | AYM13_RS10105 | Protein ID | WP_001801861.1 |
Coordinates | 1961737..1961832 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1961860..1961919 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AYM13_RS10055 | 1957397..1958023 | + | 627 | Protein_1898 | hypothetical protein | - |
AYM13_RS10060 | 1958064..1958408 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
AYM13_RS10065 | 1958506..1959057 | + | 552 | WP_000414205.1 | hypothetical protein | - |
AYM13_RS10070 | 1959275..1959916 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
AYM13_RS10075 | 1960030..1960215 | - | 186 | WP_000809857.1 | hypothetical protein | - |
AYM13_RS10080 | 1960217..1960393 | - | 177 | WP_000375476.1 | hypothetical protein | - |
AYM13_RS10085 | 1960404..1960787 | - | 384 | WP_000070811.1 | hypothetical protein | - |
AYM13_RS10095 | 1961391..1961534 | - | 144 | WP_001549059.1 | transposase | - |
AYM13_RS10105 | 1961737..1961832 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1961860..1961919 | - | 60 | - | - | Antitoxin |
AYM13_RS10110 | 1961955..1962056 | + | 102 | WP_001791893.1 | hypothetical protein | - |
AYM13_RS10115 | 1962034..1962210 | - | 177 | Protein_1908 | transposase | - |
AYM13_RS10120 | 1962404..1962781 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1935712..1995008 | 59296 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T60804 WP_001801861.1 NZ_CP014362:1961737-1961832 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T60804 NZ_CP014362:1961737-1961832 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT60804 NZ_CP014362:c1961919-1961860 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|