Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 93330..93600 | Replicon | plasmid pJJ1887-4 |
| Accession | NZ_CP014321 | ||
| Organism | Escherichia coli JJ1887 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | AX202_RS26885 | Protein ID | WP_001312861.1 |
| Coordinates | 93442..93600 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 93330..93393 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AX202_RS26855 | 89124..89651 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| AX202_RS26860 | 89707..89940 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| AX202_RS26865 | 89999..91957 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
| AX202_RS26870 | 92012..92446 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
| AX202_RS26875 | 92443..93162 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
| AX202_RS30390 | 93174..93362 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 93174..93398 | + | 225 | NuclAT_0 | - | - |
| - | 93174..93398 | + | 225 | NuclAT_0 | - | - |
| - | 93174..93398 | + | 225 | NuclAT_0 | - | - |
| - | 93174..93398 | + | 225 | NuclAT_0 | - | - |
| - | 93330..93393 | - | 64 | - | - | Antitoxin |
| AX202_RS26885 | 93442..93600 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| AX202_RS26890 | 93951..94655 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| AX202_RS26895 | 94708..96603 | + | 1896 | Protein_116 | Tn3 family transposase | - |
| AX202_RS26900 | 96702..97355 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| AX202_RS30330 | 97448..97705 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| AX202_RS26910 | 97638..98039 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaOXA-1 / aac(6')-Ib-cr / blaTEM-1B | - | 1..107507 | 107507 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T60734 WP_001312861.1 NZ_CP014321:93442-93600 [Escherichia coli JJ1887]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T60734 NZ_CP014321:93442-93600 [Escherichia coli JJ1887]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT60734 NZ_CP014321:c93393-93330 [Escherichia coli JJ1887]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|