Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 4947382..4947603 | Replicon | chromosome |
Accession | NZ_CP014314 | ||
Organism | Escherichia coli O157:H7 strain JEONG-1266 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | JEONG1266_RS31900 | Protein ID | WP_001295224.1 |
Coordinates | 4947496..4947603 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 4947382..4947447 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JEONG1266_RS25380 | 4942822..4943724 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
JEONG1266_RS25385 | 4943735..4944718 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
JEONG1266_RS25390 | 4944715..4945719 | + | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
JEONG1266_RS25395 | 4945749..4947020 | - | 1272 | WP_001301684.1 | amino acid permease | - |
- | 4947382..4947447 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 4947382..4947447 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 4947382..4947447 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 4947382..4947447 | - | 66 | NuclAT_16 | - | Antitoxin |
- | 4947382..4947447 | - | 66 | NuclAT_21 | - | Antitoxin |
- | 4947382..4947447 | - | 66 | NuclAT_21 | - | Antitoxin |
- | 4947382..4947447 | - | 66 | NuclAT_21 | - | Antitoxin |
- | 4947382..4947447 | - | 66 | NuclAT_21 | - | Antitoxin |
JEONG1266_RS31900 | 4947496..4947603 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
JEONG1266_RS25410 | 4947690..4949369 | - | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
JEONG1266_RS25415 | 4949366..4949557 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
JEONG1266_RS25420 | 4949554..4951125 | - | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
JEONG1266_RS25425 | 4951398..4951586 | + | 189 | WP_001063316.1 | YhjR family protein | - |
JEONG1266_RS25430 | 4951598..4951795 | + | 198 | WP_000279508.1 | AAA family ATPase | - |
JEONG1266_RS25435 | 4951814..4952350 | + | 537 | WP_001270903.1 | cellulose synthase operon protein YhjQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T60684 WP_001295224.1 NZ_CP014314:4947496-4947603 [Escherichia coli O157:H7]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T60684 NZ_CP014314:4947496-4947603 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT60684 NZ_CP014314:c4947447-4947382 [Escherichia coli O157:H7]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|