Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2742236..2742461 | Replicon | chromosome |
Accession | NZ_CP014314 | ||
Organism | Escherichia coli O157:H7 strain JEONG-1266 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | JEONG1266_RS14770 | Protein ID | WP_000813263.1 |
Coordinates | 2742236..2742391 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2742403..2742461 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JEONG1266_RS14735 | 2737690..2738403 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
JEONG1266_RS14740 | 2738541..2738737 | - | 197 | Protein_2807 | TrmB family transcriptional regulator | - |
JEONG1266_RS14745 | 2739024..2739842 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
JEONG1266_RS14750 | 2739994..2740365 | - | 372 | WP_000090264.1 | antitermination protein | - |
JEONG1266_RS14755 | 2740355..2740726 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
JEONG1266_RS14760 | 2740739..2741788 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
JEONG1266_RS31630 | 2741790..2742068 | - | 279 | WP_001341388.1 | hypothetical protein | - |
JEONG1266_RS14770 | 2742236..2742391 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2742403..2742461 | + | 59 | - | - | Antitoxin |
JEONG1266_RS14775 | 2742996..2743769 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
JEONG1266_RS14780 | 2744121..2744534 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
JEONG1266_RS14785 | 2744550..2745320 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
JEONG1266_RS14790 | 2745342..2746088 | - | 747 | WP_000788745.1 | ATP-binding protein | - |
JEONG1266_RS14795 | 2746095..2747186 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T60674 WP_000813263.1 NZ_CP014314:c2742391-2742236 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T60674 NZ_CP014314:c2742391-2742236 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT60674 NZ_CP014314:2742403-2742461 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|