Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1865663..1865888 | Replicon | chromosome |
| Accession | NZ_CP014314 | ||
| Organism | Escherichia coli O157:H7 strain JEONG-1266 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | JEONG1266_RS10005 | Protein ID | WP_000813258.1 |
| Coordinates | 1865733..1865888 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1865663..1865721 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JEONG1266_RS09955 | 1860728..1860970 | + | 243 | WP_000747948.1 | hypothetical protein | - |
| JEONG1266_RS09960 | 1860954..1861379 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
| JEONG1266_RS32365 | 1861448..1862491 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
| JEONG1266_RS32370 | 1862484..1862945 | + | 462 | WP_000139447.1 | replication protein | - |
| JEONG1266_RS09975 | 1862979..1863695 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| JEONG1266_RS09980 | 1863728..1864009 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
| JEONG1266_RS09985 | 1864006..1864233 | + | 228 | WP_000699809.1 | hypothetical protein | - |
| JEONG1266_RS09990 | 1864226..1864537 | + | 312 | WP_001289673.1 | hypothetical protein | - |
| JEONG1266_RS09995 | 1864665..1864883 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
| JEONG1266_RS10000 | 1864885..1865442 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| - | 1865663..1865721 | - | 59 | - | - | Antitoxin |
| JEONG1266_RS10005 | 1865733..1865888 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| JEONG1266_RS10010 | 1866008..1866352 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| JEONG1266_RS10015 | 1866474..1866746 | + | 273 | WP_000191872.1 | hypothetical protein | - |
| JEONG1266_RS10020 | 1866748..1867797 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| JEONG1266_RS10025 | 1867810..1868115 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| JEONG1266_RS10030 | 1868178..1868732 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
| JEONG1266_RS32375 | 1868957..1869154 | + | 198 | WP_000917763.1 | hypothetical protein | - |
| JEONG1266_RS10040 | 1869290..1870003 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| JEONG1266_RS10055 | 1870454..1870885 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 1797272..1902010 | 104738 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T60670 WP_000813258.1 NZ_CP014314:1865733-1865888 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T60670 NZ_CP014314:1865733-1865888 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT60670 NZ_CP014314:c1865721-1865663 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|