Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1375606..1375828 Replicon chromosome
Accession NZ_CP014272
Organism Escherichia coli K-12 strain K-12 C3026

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag C3026_RS07120 Protein ID WP_000170955.1
Coordinates 1375606..1375713 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1375761..1375828 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C3026_RS07090 1371462..1372295 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
C3026_RS07095 1372292..1372684 + 393 WP_000200374.1 invasion regulator SirB2 -
C3026_RS07100 1372688..1373497 + 810 WP_001257044.1 invasion regulator SirB1 -
C3026_RS07105 1373533..1374387 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
C3026_RS07110 1374536..1374643 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1374691..1374757 + 67 NuclAT_34 - -
- 1374691..1374757 + 67 NuclAT_34 - -
- 1374691..1374757 + 67 NuclAT_34 - -
- 1374691..1374757 + 67 NuclAT_34 - -
- 1374691..1374757 + 67 NuclAT_36 - -
- 1374691..1374757 + 67 NuclAT_36 - -
- 1374691..1374757 + 67 NuclAT_36 - -
- 1374691..1374757 + 67 NuclAT_36 - -
- 1374691..1374757 + 67 NuclAT_38 - -
- 1374691..1374757 + 67 NuclAT_38 - -
- 1374691..1374757 + 67 NuclAT_38 - -
- 1374691..1374757 + 67 NuclAT_38 - -
- 1374691..1374757 + 67 NuclAT_40 - -
- 1374691..1374757 + 67 NuclAT_40 - -
- 1374691..1374757 + 67 NuclAT_40 - -
- 1374691..1374757 + 67 NuclAT_40 - -
- 1374691..1374757 + 67 NuclAT_42 - -
- 1374691..1374757 + 67 NuclAT_42 - -
- 1374691..1374757 + 67 NuclAT_42 - -
- 1374691..1374757 + 67 NuclAT_42 - -
- 1374691..1374757 + 67 NuclAT_44 - -
- 1374691..1374757 + 67 NuclAT_44 - -
- 1374691..1374757 + 67 NuclAT_44 - -
- 1374691..1374757 + 67 NuclAT_44 - -
- 1374693..1374758 + 66 NuclAT_18 - -
- 1374693..1374758 + 66 NuclAT_18 - -
- 1374693..1374758 + 66 NuclAT_18 - -
- 1374693..1374758 + 66 NuclAT_18 - -
- 1374693..1374758 + 66 NuclAT_21 - -
- 1374693..1374758 + 66 NuclAT_21 - -
- 1374693..1374758 + 66 NuclAT_21 - -
- 1374693..1374758 + 66 NuclAT_21 - -
- 1374693..1374758 + 66 NuclAT_24 - -
- 1374693..1374758 + 66 NuclAT_24 - -
- 1374693..1374758 + 66 NuclAT_24 - -
- 1374693..1374758 + 66 NuclAT_24 - -
- 1374693..1374758 + 66 NuclAT_27 - -
- 1374693..1374758 + 66 NuclAT_27 - -
- 1374693..1374758 + 66 NuclAT_27 - -
- 1374693..1374758 + 66 NuclAT_27 - -
- 1374693..1374758 + 66 NuclAT_30 - -
- 1374693..1374758 + 66 NuclAT_30 - -
- 1374693..1374758 + 66 NuclAT_30 - -
- 1374693..1374758 + 66 NuclAT_30 - -
- 1374693..1374758 + 66 NuclAT_33 - -
- 1374693..1374758 + 66 NuclAT_33 - -
- 1374693..1374758 + 66 NuclAT_33 - -
- 1374693..1374758 + 66 NuclAT_33 - -
C3026_RS07115 1375071..1375178 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1375226..1375293 + 68 NuclAT_17 - -
- 1375226..1375293 + 68 NuclAT_17 - -
- 1375226..1375293 + 68 NuclAT_17 - -
- 1375226..1375293 + 68 NuclAT_17 - -
- 1375226..1375293 + 68 NuclAT_20 - -
- 1375226..1375293 + 68 NuclAT_20 - -
- 1375226..1375293 + 68 NuclAT_20 - -
- 1375226..1375293 + 68 NuclAT_20 - -
- 1375226..1375293 + 68 NuclAT_23 - -
- 1375226..1375293 + 68 NuclAT_23 - -
- 1375226..1375293 + 68 NuclAT_23 - -
- 1375226..1375293 + 68 NuclAT_23 - -
- 1375226..1375293 + 68 NuclAT_26 - -
- 1375226..1375293 + 68 NuclAT_26 - -
- 1375226..1375293 + 68 NuclAT_26 - -
- 1375226..1375293 + 68 NuclAT_26 - -
- 1375226..1375293 + 68 NuclAT_29 - -
- 1375226..1375293 + 68 NuclAT_29 - -
- 1375226..1375293 + 68 NuclAT_29 - -
- 1375226..1375293 + 68 NuclAT_29 - -
- 1375226..1375293 + 68 NuclAT_32 - -
- 1375226..1375293 + 68 NuclAT_32 - -
- 1375226..1375293 + 68 NuclAT_32 - -
- 1375226..1375293 + 68 NuclAT_32 - -
- 1375227..1375292 + 66 NuclAT_35 - -
- 1375227..1375292 + 66 NuclAT_35 - -
- 1375227..1375292 + 66 NuclAT_35 - -
- 1375227..1375292 + 66 NuclAT_35 - -
- 1375227..1375292 + 66 NuclAT_37 - -
- 1375227..1375292 + 66 NuclAT_37 - -
- 1375227..1375292 + 66 NuclAT_37 - -
- 1375227..1375292 + 66 NuclAT_37 - -
- 1375227..1375292 + 66 NuclAT_39 - -
- 1375227..1375292 + 66 NuclAT_39 - -
- 1375227..1375292 + 66 NuclAT_39 - -
- 1375227..1375292 + 66 NuclAT_39 - -
- 1375227..1375292 + 66 NuclAT_41 - -
- 1375227..1375292 + 66 NuclAT_41 - -
- 1375227..1375292 + 66 NuclAT_41 - -
- 1375227..1375292 + 66 NuclAT_41 - -
- 1375227..1375292 + 66 NuclAT_43 - -
- 1375227..1375292 + 66 NuclAT_43 - -
- 1375227..1375292 + 66 NuclAT_43 - -
- 1375227..1375292 + 66 NuclAT_43 - -
- 1375227..1375292 + 66 NuclAT_45 - -
- 1375227..1375292 + 66 NuclAT_45 - -
- 1375227..1375292 + 66 NuclAT_45 - -
- 1375227..1375292 + 66 NuclAT_45 - -
C3026_RS07120 1375606..1375713 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 1375761..1375828 + 68 NuclAT_16 - Antitoxin
- 1375761..1375828 + 68 NuclAT_16 - Antitoxin
- 1375761..1375828 + 68 NuclAT_16 - Antitoxin
- 1375761..1375828 + 68 NuclAT_16 - Antitoxin
- 1375761..1375828 + 68 NuclAT_19 - Antitoxin
- 1375761..1375828 + 68 NuclAT_19 - Antitoxin
- 1375761..1375828 + 68 NuclAT_19 - Antitoxin
- 1375761..1375828 + 68 NuclAT_19 - Antitoxin
- 1375761..1375828 + 68 NuclAT_22 - Antitoxin
- 1375761..1375828 + 68 NuclAT_22 - Antitoxin
- 1375761..1375828 + 68 NuclAT_22 - Antitoxin
- 1375761..1375828 + 68 NuclAT_22 - Antitoxin
- 1375761..1375828 + 68 NuclAT_25 - Antitoxin
- 1375761..1375828 + 68 NuclAT_25 - Antitoxin
- 1375761..1375828 + 68 NuclAT_25 - Antitoxin
- 1375761..1375828 + 68 NuclAT_25 - Antitoxin
- 1375761..1375828 + 68 NuclAT_28 - Antitoxin
- 1375761..1375828 + 68 NuclAT_28 - Antitoxin
- 1375761..1375828 + 68 NuclAT_28 - Antitoxin
- 1375761..1375828 + 68 NuclAT_28 - Antitoxin
- 1375761..1375828 + 68 NuclAT_31 - Antitoxin
- 1375761..1375828 + 68 NuclAT_31 - Antitoxin
- 1375761..1375828 + 68 NuclAT_31 - Antitoxin
- 1375761..1375828 + 68 NuclAT_31 - Antitoxin
C3026_RS07125 1376117..1377217 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
C3026_RS07130 1377487..1377717 + 231 WP_001146444.1 putative cation transport regulator ChaB -
C3026_RS07135 1377875..1378570 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
C3026_RS07140 1378614..1378967 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
C3026_RS07145 1379152..1380546 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T60570 WP_000170955.1 NZ_CP014272:c1375713-1375606 [Escherichia coli K-12]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T60570 NZ_CP014272:c1375713-1375606 [Escherichia coli K-12]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT60570 NZ_CP014272:1375761-1375828 [Escherichia coli K-12]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A829J2A9


Antitoxin

Download structure file

References